Entry information : CsaPrx71 (Cucsa.229270.1)
Entry ID 8845
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-18 (Christophe Dunand)
Peroxidase information: CsaPrx71 (Cucsa.229270.1)
Name (synonym) CsaPrx71 (Cucsa.229270.1)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx71
start..stop
S start..stop
CsaPrx05 563 0 11..321 6..317
LePrx26 476 3e-171 5..321 1..320
CclPrx103 476 5.85e-171 12..320 14..323
EgrPrx144 475 1.4e-170 3..321 7..326
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8845' 'join(67487..67897,67994..68159,68291..68676)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 67487..67897 409 N° 2 67994..68159 164 N° 3 68291..68676 384  
join(67487..67897,67994..68159,68291..68676)


exon

Literature and cross-references CsaPrx71 (Cucsa.229270.1)
DNA ref. Phytozome 12:   scaffold01939 (67487..68676)
Protein sequence: CsaPrx71 (Cucsa.229270.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (294)
PWM (Da):   %s   34572.43 (31817.9)  
PI (pH):   %s   7.72 (7.72) Peptide Signal:   %s   cut: 27 range:27-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAATVTTKLVILITAMALLLLGTTEAQLSPTFYDQTCPTALTTIRTVIRQAVSQERRMAASLIRLHFHDCFVQGCDASILLDDTPSMIGEQNAAPNINSARGYGVIHKAKTEVEKRCPGT
VSCADILAVAARDASFSVGGPSWTVKLGRRDSTSASKTLAESELPHFQESLDRLISIFANKGLSTRDMVALSGSHTIGQSQCFLFRNRIYNQSNIDAGFARTRQRNCPSSGGNGNLAPLD
LVTPNSFDNNYFKNLIQMKGLLETDQVLFSGGSTDNIVTEYSRNPSTFKSDFAAAMIKMGDIQPLTGLEGEIRNICGAVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 2 and 3).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTACGGTGACCACAAAACTAGTCATTCTTATAACTGCAATGGCGTTATTACTTTTGGGCACAACTGAAGCCCAACTTTCGCCTACATTCTACGATCAAACTTGTCCTACTGCA
CTCACTACTATTAGAACTGTTATTAGGCAAGCAGTTTCTCAAGAACGTCGAATGGCTGCATCTCTCATTCGACTTCATTTCCATGATTGTTTTGTTCAAGGTTGTGATGCATCAATTTTA
CTCGATGATACTCCCTCTATGATTGGTGAACAAAATGCAGCACCAAACATAAACTCTGCAAGAGGTTATGGAGTGATTCATAAGGCTAAAACTGAAGTTGAGAAGAGATGTCCTGGCACA
GTATCTTGTGCAGACATCCTTGCTGTGGCTGCAAGAGATGCATCTTTTTCT
CTGTAAGTACTGACTTTTAATACGTTTATTTAGTCTATAATGTAATAATATGTTATGGAACAATGTTTT
TTCTAATAGTATATATTGTTGTCAAATAGGTTGGTGGTCCATCTTGGACGGTAAAGCTTGGAAGAAGAGATTCTACCTCTGCAAGTAAAACTTTAGCAGAGAGTGAGCTTCCACATTTCC
AAGAAAGCCTTGACAGACTTATATCCATTTTTGCAAATAAAGGTCTTAGCACCAGAGATATGGTTGCACTCTCAG
AGGTAAATTAGATTAGATGACACAATATTTAAATTCCTTTGCACA
CTATATATACACACGTGCGTGTGTGTGTATATGTATGTATATTCCTTGGCTTCCATCATTTAAATATATGTTTACTACTCTATGGCAGGTTCTCATACTATAGGACAATCTCAATGCTTT
CTTTTTCGCAATAGGATATACAACCAAAGCAATATTGATGCAGGATTTGCTCGCACTCGACAAAGAAATTGTCCATCATCGGGTGGGAATGGAAATTTGGCACCACTTGATTTGGTCACA
CCCAATTCTTTTGACAATAATTATTTCAAAAATCTTATTCAAATGAAGGGTTTGCTTGAAACAGATCAAGTTCTTTTTAGTGGAGGATCAACGGATAATATTGTTACTGAATACAGTAGA
AATCCAAGTACATTCAAATCGGATTTTGCGGCTGCCATGATTAAAATGGGAGACATCCAACCTCTTACTGGTTTAGAAGGAGAAATAAGAAATATATGTGGTGCGGTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTACGGTGACCACAAAACTAGTCATTCTTATAACTGCAATGGCGTTATTACTTTTGGGCACAACTGAAGCCCAACTTTCGCCTACATTCTACGATCAAACTTGTCCTACTGCA
CTCACTACTATTAGAACTGTTATTAGGCAAGCAGTTTCTCAAGAACGTCGAATGGCTGCATCTCTCATTCGACTTCATTTCCATGATTGTTTTGTTCAAGGTTGTGATGCATCAATTTTA
CTCGATGATACTCCCTCTATGATTGGTGAACAAAATGCAGCACCAAACATAAACTCTGCAAGAGGTTATGGAGTGATTCATAAGGCTAAAACTGAAGTTGAGAAGAGATGTCCTGGCACA
GTATCTTGTGCAGACATCCTTGCTGTGGCTGCAAGAGATGCATCTTTTTCT
GTTGGTGGTCCATCTTGGACGGTAAAGCTTGGAAGAAGAGATTCTACCTCTGCAAGTAAAACTTTAGCA
GAGAGTGAGCTTCCACATTTCCAAGAAAGCCTTGACAGACTTATATCCATTTTTGCAAATAAAGGTCTTAGCACCAGAGATATGGTTGCACTCTCAG
GTTCTCATACTATAGGACAATCT
CAATGCTTTCTTTTTCGCAATAGGATATACAACCAAAGCAATATTGATGCAGGATTTGCTCGCACTCGACAAAGAAATTGTCCATCATCGGGTGGGAATGGAAATTTGGCACCACTTGAT
TTGGTCACACCCAATTCTTTTGACAATAATTATTTCAAAAATCTTATTCAAATGAAGGGTTTGCTTGAAACAGATCAAGTTCTTTTTAGTGGAGGATCAACGGATAATATTGTTACTGAA
TACAGTAGAAATCCAAGTACATTCAAATCGGATTTTGCGGCTGCCATGATTAAAATGGGAGACATCCAACCTCTTACTGGTTTAGAAGGAGAAATAAGAAATATATGTGGTGCGGTCAAT
TAA

Retrieve as FASTA