Entry information : CsaPrx77 (Cucsa.284220.1)
Entry ID 8850
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CsaPrx77 (Cucsa.284220.1)
Name (synonym) CsaPrx77 (Cucsa.284220.1)
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx77
start..stop
S start..stop
MePrx12 525 0 3..341 7..340
PpePrx72 525 0 12..341 15..340
VvPrx48 519 0 27..341 27..339
MePrx128 516 0 25..341 28..342
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1064503..1064739 237 N° 2 1063258..1063449 192 N° 3 1062722..1062887 166 N° 4 1061753..1062183 431
complement(join(1061753..1062183,1062722..1062887,1063258..1063449,1064503..1064 739))


exon

Literature and cross-references CsaPrx77 (Cucsa.284220.1)
DNA ref. Phytozome 12:   scaffold02653 (1064739..1061753)
Protein sequence: CsaPrx77 (Cucsa.284220.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   342
PWM (Da):   %s   37629.83 Transmb domain:   %s   i7-26o
PI (pH):   %s   5.42
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGISNKVYGVVMMIVFCGLFVVSYSLFETGETRLTLDYYTRTCPNVLQIVRKEMECAVLSEPRNAAFVVRLHFHDCFVQGCDGSVLLDDTITLQGEKKASNNIHSLKGFRIIDRIKNSIESECPGIVSCADILTIAARDAVILVGGPYWDVPLGRKDSTSASYELANTNLPSANEGLLSIISKFLYQGLSVTDMVALSGAHTIGMARCKNFRQRIYGDFDATSDPNNPISGSYIEKLRSICPLVGKTGEDNITAMDNMTPELFDNSYFHILMRGEGVLNSDQELYSSLLGIETKALVKKYAADPIAFFQQFSDSMVKLGNITNSDSFVNGEVRKNCRFINT*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAATCTCAAATAAAGTTTATGGAGTTGTAATGATGATTGTGTTCTGTGGTTTGTTTGTTGTGAGCTATAGTTTGTTTGAAACAGGGGAGACCCGGTTGACATTGGATTACTATACC
AGAACTTGTCCCAATGTGTTGCAGATCGTGAGGAAAGAAATGGAGTGTGCTGTTCTTTCTGAACCACGTAATGCAGCTTTTGTTGTTCGATTGCACTTTCATGATTGTTTCGTTCAG
GTT
CGTTTCCTCGTCTATTTCACTTGTATTATATTGAAAAGTGAAAATTTGATAAAGTTTGTGTTTCATGTTTATTATGTCTTATTTCTCGTTTGTTTTGTTCGGTAATTAGACTGCAGCTCA
TTCATATTTACCCTATCTTTCTAAAACGCAAAGAAAAAGTAGAAAACAATTCAATTTTTTACATCTACAAATTTTATCGGACAATCCGTTACAATGCACAAACATAGATGAAATATCCAA
GTTCTTTTTCTTAAAAAACAAGGAAGAACAAAAAGTCCATGAAAGGTAATTGTTTCTTTGTTATAATTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCT
AAGTGTTGGAGATTATGGAATCTCGTACAATCAAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAACTAATTGATTTTTAGAAAGTTGAAAGCAAGAGATGGAATGCAAA
CGTAGTTATATTTGTTTAGAGATCAAATGGTTTATGCAAACAAAATTTGTATCATTATGTTTTTGTTTTTTATAAGACATTGGTTAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATGGAAAGGTTCTTACAAGTGGAAAAGGATAAACAAAGAACA
ATTAACATATGAATGTCACCAAATTAGGATTCGACATTTAGTAGGTAACCAAGTCTTCTTTAACATCCTTTTCACAGTTCATGTTTCACACACTCATGTCCGTTCTTTATGATTCACTTG
GGACTTTCGAGCACTTGTGTGCATCTGAGTTTTGTTTTTACCTGATAAGATATTTGTATGAACTTAACTAACTGTTAGGATCTGAATTAGGGGTGCGACGGATCGGTTTTACTGGACGAC
ACAATAACATTACAGGGAGAAAAAAAAGCTTCCAACAACATACACTCTCTCAAAGGCTTTAGAATCATTGATAGGATAAAGAACAGCATTGAATCAGAATGTCCTGGGATTGTTTCTTGT
GCTGATATACTCACTATTGCAGCCAGGGATGCTGTTATTCTG
GTAATTTTTAATCCCAAATTTATTTACAACCTTAAGAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNACTGTCGTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNTATTTTGACTTGTTCTCTCTAATAAAACTTTTCTCGTTTGGCAGGTGGGTGGGCCTTACTGGGATGTTCCACTAGGAAGAAAGGATTCGACGAGTGCAAGTTATGAACTTGC
AAACACAAATCTTCCCTCTGCCAATGAGGGGCTTCTCAGCATCATCTCGAAGTTTCTATATCAGGGTCTCTCGGTTACTGACATGGTAGCTCTATCAG
GTATATTAAACTCTTTCAATTT
AGGTTTCTAATGTTGTTATCGAATTTTAAGAAGTTCCCAAACTTTTTAGTTGGTATTATACACAAGTAGTCTATGTCATTCCATTATTTTTAACACTTTCATGGCACATTTGCTGTATTA
ACCTTCAATGTCGTACTCTTTTCTTCGTTGAATTTAGCAATTGTTTGATAGGAAGATGGAACCGTCGACCCTAATTGAAATTGTAGCAAGTTTCTTATCTATCAAGCCGATTGCATTAAC
TCAACCAATAAAGACCTAATAGATAGAAAAATTGAAAGCTCATAGTTTATTGAGATTTTTTTTTTAAACATAGAGACTTAATAAACATAGTTTTGGAAGTATAGGACTAACTGACAAAAC
TTTAGAGTAAGTTAATGTAATCTAACAGTTGCATTTCTAAATCTTTCTGATATACTTCTGCGAAATGTCAACAATATTATGGAAGCTATTGTTAAAACTTTGGGTCAGTTTAAAGAGAGA
GTTAAATTTTGGTGAGTTTGGAGTTGTATTGTTCAGGAGCGCACACGATCGGAATGGCGAGGTGCAAGAATTTCAGACAGAGAATTTACGGGGATTTCGACGCAACTTCAGATCCAAACA
ACCCGATTTCGGGGTCGTACATCGAGAAGTTGAGGTCAATTTGTCCATTAGTTGGTAAAACAGGAGAGGACAACATAACAGCAATGGACAATATGACACCAGAGCTATTTGACAACTCTT
ATTTCCATATTTTGATGAGAGGAGAAGGGGTTTTGAATTCAGATCAAGAATTGTATTCAAGCCTTTTGGGCATAGAAACTAAGGCATTGGTGAAGAAATATGCTGCAGATCCAATTGCTT
TCTTTCAGCAATTCTCTGATTCTATGGTGAAATTGGGAAATATTACCAATTCTGATAGCTTTGTCAATGGGGAAGTTAGGAAAAACTGCAGGTTTATTAATACATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAATCTCAAATAAAGTTTATGGAGTTGTAATGATGATTGTGTTCTGTGGTTTGTTTGTTGTGAGCTATAGTTTGTTTGAAACAGGGGAGACCCGGTTGACATTGGATTACTATACC
AGAACTTGTCCCAATGTGTTGCAGATCGTGAGGAAAGAAATGGAGTGTGCTGTTCTTTCTGAACCACGTAATGCAGCTTTTGTTGTTCGATTGCACTTTCATGATTGTTTCGTTCAG
GGG
TGCGACGGATCGGTTTTACTGGACGACACAATAACATTACAGGGAGAAAAAAAAGCTTCCAACAACATACACTCTCTCAAAGGCTTTAGAATCATTGATAGGATAAAGAACAGCATTGAA
TCAGAATGTCCTGGGATTGTTTCTTGTGCTGATATACTCACTATTGCAGCCAGGGATGCTGTTATTCTG
GTGGGTGGGCCTTACTGGGATGTTCCACTAGGAAGAAAGGATTCGACGAGT
GCAAGTTATGAACTTGCAAACACAAATCTTCCCTCTGCCAATGAGGGGCTTCTCAGCATCATCTCGAAGTTTCTATATCAGGGTCTCTCGGTTACTGACATGGTAGCTCTATCAG
GAGCG
CACACGATCGGAATGGCGAGGTGCAAGAATTTCAGACAGAGAATTTACGGGGATTTCGACGCAACTTCAGATCCAAACAACCCGATTTCGGGGTCGTACATCGAGAAGTTGAGGTCAATT
TGTCCATTAGTTGGTAAAACAGGAGAGGACAACATAACAGCAATGGACAATATGACACCAGAGCTATTTGACAACTCTTATTTCCATATTTTGATGAGAGGAGAAGGGGTTTTGAATTCA
GATCAAGAATTGTATTCAAGCCTTTTGGGCATAGAAACTAAGGCATTGGTGAAGAAATATGCTGCAGATCCAATTGCTTTCTTTCAGCAATTCTCTGATTCTATGGTGAAATTGGGAAAT
ATTACCAATTCTGATAGCTTTGTCAATGGGGAAGTTAGGAAAAACTGCAGGTTTATTAATACATGA

Retrieve as FASTA