Entry information : CsaPrx81 (Cucsa.292740.1)
Entry ID 8852
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2014-03-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-03-28 (Christophe Dunand)
Peroxidase information: CsaPrx81 (Cucsa.292740.1)
Name (synonym) CsaPrx81 (Cucsa.292740.1)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx81
start..stop
S start..stop
RcPrx09 474 1.01e-170 11..299 33..321
AcoPrx83 467 8.67e-168 13..299 37..323
InPrx44 461 1.74e-165 11..299 35..323
NnPrx99 461 1.8e-165 13..299 37..323
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8852' 'join(310016..310180,310274..310453,315211..315373,315776..316197)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 310016..310180 163 N° 2 310274..310453 178 N° 3 315211..315373 161 N° 4 315776..316197 420
join(310016..310180,310274..310453,315211..315373,315776..316197)


exon

Literature and cross-references CsaPrx81 (Cucsa.292740.1)
DNA ref. Phytozome 12:   scaffold02779 (310046..316197)
Protein sequence: CsaPrx81 (Cucsa.292740.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   299
PWM (Da):   %s   33392.92  
PI (pH):   %s   7.06
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGFILFHVQKQNQSIVRNTVESYMNTDPTIAAGLLRLHFHDCFVQGCDGSVLISGNLAERNALPNLGLRGFEVIEDAKSELEAECPGIVSCADILALAARDAVDLSKGPSWSVPTGRRDG
RVSSKSEAQNLPSPLESIAVHKKKFAEKGLDEQDLLTLLGAHTIGQTDCLFFRYRLHNFTTTCNSDPTINPSFLTELKELCPNDGDATKRVALDKDSQFKFDLSFFNNIKDGNGVLESDQ
RLWNDDSTRSIIQKYISPLRGLLGLRFDYNFRKSMIKMSSIEVKTGMQVEIRRKCSRFN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 iotrons). Incorrect prediction from Phytozome (exons 1 and 2are ot predicted).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTTATTCTTTTTCATGTCCAAAAGCAGAATCAATCTATAGTGAGAAATACGGTTGAATCGTACATGAATACCGATCCTACCATTGCAGCTGGGTTATTGAGGCTTCATTTTCAC
GACTGTTTTGTGCAGGTTATTGCTCTTCATCATTTGGTTTTTAAT
ATTGTAGTTAACTTACGAGAATCATTGTATATAATAGTAATGGGTTTTTTTATACATATTGGCAGGGGTGTGATG
GTTCAGTGTTGATTTCGGGTAATTTGGCTGAGAGAAATGCTTTGCCAAACCTTGGATTAAGAGGGTTTGAAGTAATTGAAGATGCAAAATCAGAGCTTGAAGCTGAGTGTCCTGGCATTG
TCTCTTGTGCAGATATTCTTGCTTTGGCTGCCCGTGATGCCGTTGACTTGGTAATACTATGTATCTTTTCATGGCTTAGA
GACTATATAATATTAGATCTCAAATGAAACCTCTACTTGG
TTCACAAGATGTGTGGACATTGTTAATTAATAATGGCTATGAATAACCAGAAAGTGATACGACTTTGAGTCAAGCTGAGAGAAACTTTACAAAATACAAGAAAGAAAGATCAAAAGGCTC
TCACCATCATTCATCAAGTCATTGATGATTCAAAATGTGAGAATATTTATGGAGCAACTATTGCACATCAAGCATCGCAAATTTTGGAGAATAAGTATAAAGGAGTAGATTGAGTCAAGA
ATGTTTCATCTTCAAAAATTAAGAGGTGATTATGAGTCGCTGCCTATTAAGAAGTCTGAATTAGTATCAAATTATACTTCAAGATTGCTAGTAGTAGTAAATGAAATAATAAGATATGGG
TGAGACAATAAGTGATGAGCAAGTAGTAGAAAAGACAATTTAATTTGTTCATATATTAGACAAAAAATTCAATTTCATCGTTGTAGCTATTAAAGAATCAAAGAATTTGAGTACAATGTC
CGTTGACTACTTAGCTCTTTACAAGTCCATGAAGAGAGGCTTCTCAAGACGAACAAGCATACAACTGAGCAACTCTTTTCAATCAAAGTTGCAATTGAAAGATAGAAAGACCACTTAGAA
AAAAGGCACAATTGTTATCAAAGGACGTAGTGGCAATCGTGGATGTGGTAATTTCACAGGCCGAGGTTGAGTTAAACTATGGTCAAAGAAAATTTGATAAAGAGTAATTCAAACTCAAAT
TCATCAAGAGGTCGTGGAAGACAAAACTATTCGTGTTCAGGGTGAGCTAATGCTTGTTGGGTATTTTGGTTTGACACTACTTCACACCCAAAAAGAAGTGAGTTACGTCTGAGTTAAACT
TGGAGATGGAAGTCTTCTTTCATTTCTCGACGATGAAGTAAGACTAAGCTTATGAGCTTATTATCCTAGGTCGGAACAAGTTGATAGGATCCCATTTTTTACGTCCCCTGACAAAAGATG
GGTTTAATGTTATAGTTGTCATAAATTTAGCCATTATTCCTAAGAGTTGTGCACAAATAGAGTTGAAGAAAATGCAAATTATGCTTAGAAAGATGAAGAAAATAATAAGTCATCACTGCT
TCTAGCTTGCGAAAGCGAGGAAGCATGTGAATACAATGCATGGTATCTCGATAGCGGTACAAGCAATCATATATGCGGAAGCAAGTTGATGTTCTTGGAGCTTGATGAGTTTGTTGCTAG
CAAAATTTAGTATTCGATGATGCCACAAAAAAATTTCAATTAAAGAAAAAGGTAATTTTTTTTATCAATTTGAAGAATTGGTAGCTTGAGTTTATCTCTAATGTTTATTATGTGTCTAAT
ATAAAGAACAATATTTTGAGTTTGGGACAACACTTAGAGAAAGGTAATATTTTGATGAAGTATTATAGTTTTTTTATAAGAGATAATCATGACAATATGATTGCTAAAGTGCAAATGACG
AAAAATAGAATGTTATTATTAAACATTCAAATTGATGTTGCTAAATGTTTGAACTCATGCTTAAATGATCCAAAGTGGATTTGGCAGTTATGGTTTAGACATTTGAGCTTTGATGACTTG
AGACTATTGACGTGGAATAACATGGTGAAAGGGCTACTATATGTCAAACATTCAGATCATTTGTGAAGGTTGTATTTATGTATATGGTAAACAATCAAGGAAGAGTTTTTCCACAAGAAT
CATCTTCAAGAGCAAGAAGACCACTAGAGTTAGTTCATATTGATCTTTGTGGACCGATGAAACGAAGTTCTTTCGGTAAGAGTAATTATTTCTTGTTATTTATTAATGATTTTCAGCTGA
AAAACTTGAGAGTTTATTGTGTCAAGGAGAAATCATAAGTATTTGGCATGTTCGAGATTTAAAGCTTTTGTTGAAAAAGAAAGTGATTATTACATAAAAGCTTTGAGCCAAATGAATTCA
AAACTTTTTGCGTAGAAAATGAAATTCGTTGACCTATGACAGTTTCATTTACTCCTCAATAAAAGAGCGTTATTGAGAGGAAGAATAGAACAATACTTAACATGGCTTGAAGCATGTTTA
GAGCAAGAAGATGCCAAAAGACTTTTGGGCGTAGGCTGTTGAATGTGTAGTGTACTTGTCAAATTGTTCCTCTACTAAAAGCTTGTGGAACAAAACTTCTCAACAAGCATGGCCATGAAG
AAAACCACCCATTACTCATTTGAGCGTATTTGGATGTATGGCTTATGCACATATACCTTATCAAAAGTGCTATAAGCTCGAGGATAAAAGTGAGAAACATGTTTTTATTGGTAAGCGGAG
ATGTGTTTGATGAAAAAGTATCATGCAATTGGAATGACGAACCAAAAGACTACTACAAGTTTTTGTTTTTTCCCAATGATCATGATGAATCTAGTGACATTTCTTCTATATCAGCATCAC
CAATATCGCCAAACAAACCACAACAAAACACACATTCATCATTTGCAAGTTCAAGTGAAGAGCTTCGTGACATAAGAAGTTTATGAGATATATATGATGAAACTGAAGAGTTAAGTCAAA
GTTTTAATAATAAACTTAACTTACTCTCTTTTCTATATTTTGTGACGGTGAACCTTTGAACTTTGAAGAAGCTTCACAAGATGAAAAATGAAATATTGCTATAGATGCAGAGATAAAAGT
TATAAAGAAGAATGTTTGCCTTCCAAGTGGAAAGAAAGTAGTAGGTGCCAAATGGGTGTTCAAGATAAAAAAGAAATGGAAAGCTAGGGAGAAGTGGAAAGATACAAAGCAAGATTAGTT
TCAAAAGGCTATTCTCAAAGAAAATGCATTGATTACAATATTTGCTTCCGTTGCTCGTTTGGAGACCATAAAATTGCTAATTACGCTTGTTGCATGCTCATAATAATTGGAAGTCTTTTA
GATGGATGTCAAATGAGGATCCTTAAATGGCTATCTAAAAGAAGTCTACTTAGAATAACCCCTCGTTGGTTATGTTGTGAAATGTGAAAAGGGATAAAAATCTAAATTTAAGGAACGGGT
TGAATGGATTGAAACAAGTGCCAAGAATATGGAATACCATAATCAATAAATATTTTCTTGACAATAGGTGTTTGAAGAGCCCTTATGAACATTCTCTTTGACATTAAGACTAATGGCCAC
GGACATATTTTGGTGTTTTTTTTTCTTTTCTTTTTTGTATGTGGATGACTTAATTTCTATAGAAAAATTGTACAAGTATGTTTGAAGATCTCAAGAAGGTGATAATCCAAGAATTTGAAA
TGACAGATATTGGGTTGATGTCATATTATCTTGGGATTGAGGTTATGTAGTCAGAAGAAGGTATATTCATCTCTCAATAACAATATGCTAGAGAAATTCTAGAAAAGTTCAAGATGATCA
TTTCTAAGTCTATCACAACTCCAAGTGAAATTAGGACCAAAGTGTCTAAATTTGAAGAATGAGATGTTGATCGTTCGTATTTCAAAAGTTTGGTTGAAATTTTGAGATATTAAATTTGAA
CACTACCAGATATTCTTTTCAGCATTGGATTAGTGAGCCCATTTGTGGAATTAAGCGCCTACAATTATACTCATTTGAAAGTGGCATTTATTCTTCTTTACCTCAAAGGTACGCTTAACT
ATGCAGTATTTAATCTTCATCTAAAGTATTCAAGCTTGAAGGCTATTGTGACAATGACTAGGCTAGAGATACTAATTAATTAATTATCAAAAGAGCACTTGTGGATATATTTTCCTTGTT
GGTAACAACGCATTTACTCGGAGTTCTAAGAAGCAACCTGTTGTGGCATTATCCACTAGTGAGGCAGAATATGTTTTTGCAGCTTCATATGTCTGTTATGCAGTTTGGTTAAGAAATTTG
TTAAAGACAATAAAAAATTTGCAAGATGATTCAAATGTGATTCATGTAGACAATAAGTCAACAATTGCTTTAGAGAAGAATCTCGTGTTTCATGAATTGTAGCAAACTCATTGATAAAAA
GATTTCACTTGATCAGAGATTACATTTTAAGGAAAGAGGTTCAAGTTGAATATGTAAAAAGATCCTTAAAATTAATATGTTTAACAAGTTAAAAACCTTTGCTTGGAGTTTTTAGAAAAC
ATTTTTAAGGGAGAATGTTGAAAATTAAACATGTTTTAATTTAATAACTTGTTTTATGATACGTTAAAATGTTAGAGTTAATTTAGTAACAATTTCAATATATTATTTAATTGTAGGATT
TAAAATAATGAATTTGTATAAGCGCGTGACTAATCCTATAAGTAGGATTAAAATGTTCTAATCTAAATTATGGAAGGGAATAAGAATACACATAAAGTGAGTTAAAAGTCTTTCCAATAA
GTGTTTATTTCCTCTCTTAAACATTGATTCTGTTTTGTGATTATTTATTTTGGTGTTCATCACTCACCTTACACAACAAATATGGAATAATCCTCCAGCTAACATATAATTAATTATTAT
GTTTTCATCTTTTATTAAGGTCACATTTGGAATTCTTAAAAAGTTTTCATAAAAAGAAAATTTTCATTTTGAAAACCTAAGCAAACTTTGTATTAAATTTGTCTACATTCATCCACTTAT
ATTTTTGTTATTTCATTACCAATCTTTTTTATAAGATGAAATTGGATGTTAATCTAATTAGTCGGAAAGAAATAGGGATTAAAATATGCTGATTATTATTATAAATGTTTACTTGCTTAC
ATGTTTTAGAGTAAAGGGCCAAGTTGGTCAGTGCCCACAGGAAGAAGAGATGGAAGAGTTTCTTCAAAATCCGAAGCCCAAAACTTACCTTCTCCACTCGAGTCCATTGCTGTCCACAAG
AAAAAATTTGCAGAAAAGGGCCTTGATGAACAAGACCTCCTCACCTTACTCGGTAAAAATGTTTTTCTTTCCACCGTATGAA
AACTAAACTAGATTGACGTACACATCTTTTTCATACCC
TAAATCCAAATTAGAGTGTATTTTATTTGCACCCAAAGAATTTTTTAAAAAGAGAAAAAATGTAGAGAAATATGGTCGTTATTCAATATTTTCACTAGTGCGGTATGGTTTATCTCAGCT
GCAATTTTTCGTAGTTCGTTTAAATTTTGTTCGTTGTGTAAATAGTTTCGATTTTTTTTTGCTATTCATGATTGTTGCTCTGATAATAACCATTAGATAAAATTTAAATTTTTTTAATAT
CTTCATATAAAAATTAGTTATACAATTTGAAATCATTAGAAACTACACGTTGTAACAGTTTCATCGAATTAATAATTTTTTTCGTATATATGGTAGGGGCACACACGATTGGACAAACAG
ATTGCTTGTTCTTCAGATATCGTTTACACAACTTCACAACAACATGCAACTCAGACCCAACCATAAACCCATCATTCTTAACAGAGTTGAAAGAACTTTGCCCCAATGATGGAGATGCAA
CCAAAAGGGTGGCATTGGACAAAGACAGCCAGTTCAAATTTGATCTTAGTTTCTTCAACAACATTAAAGATGGAAATGGAGTTTTGGAGTCAGACCAAAGGCTTTGGAATGATGATTCAA
CTAGAAGTATTATCCAAAAGTACATCAGCCCTTTAAGAGGACTTTTGGGGTTAAGATTTGACTACAACTTTCGGAAGTCCATGATTAAAATGAGTAGCATTGAGGTTAAGACTGGTATGC
AAGTAGAGATCAGGAGAAAATGTTCGAGATTTAATTAA

Retrieve as FASTA