Entry information : CsaPrx88 ( Cucsa.313460.1)
Entry ID 8855
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2016-01-27 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-27 (Achraf Jemmat)
Peroxidase information: CsaPrx88 ( Cucsa.313460.1)
Name (synonym) CsaPrx88 ( Cucsa.313460.1)
Class Class III peroxidase    [Orthogroup: Prx046]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx88
start..stop
S start..stop
PpePrx23 495 3e-178 4..331 1..332
VvPrx15 494 5e-178 1..331 1..331
PtPrx83 492 7e-177 24..331 31..337
CpapPrx51 486 2e-174 7..332 9..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2628779..2628994 216 N° 2 2628498..2628689 192 N° 3 2627980..2628145 166 N° 4 2627106..2627530 425
complement(join(2627106..2627530,2627980..2628145,2628498..2628689,2628779..2628 994))


exon

Literature and cross-references CsaPrx88 ( Cucsa.313460.1)
DNA ref. Phytozome 12:   scaffold02995 (2628994..2627109)
Protein sequence: CsaPrx88 ( Cucsa.313460.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (311)
PWM (Da):   %s   37359.03 (35004.6)  
PI (pH):   %s   6.26 (6.06) Peptide Signal:   %s   cut: 22 range:22-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGILKILVVVIFGVVLHGIESSGEGLLVFDYYKETCPFVEDIVRRQVEIAVLRDPRMAASLLRLHFHDCFVMGCDASVLLDSTDEMVSEKQATPNLNSLRGFSVIDKIKYILEEACPYTVSCSDILTIAARDAVVLRGGPEWAVSLGRKDSLKASFDGANKYIPSPNSSLETLIANFQQQGLNIQDLVALSGSHTIGKARCLSFRQRVYEMNGGEEEEDRYKRYNTYKRTLRSICPKTGQDQRVAPLDFRTPARFDNHYFLNILEGKGLLGSDDVLITQDYEGEIRTQVRSYASDQTLFFDSFVKSIVKMGNINVLTSHEGEVRRNCRFINH*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGATTTTGAAGATATTGGTGGTGGTAATATTTGGTGTTGTTTTGCATGGAATTGAAAGTTCAGGGGAAGGACTTTTGGTTTTTGACTATTACAAAGAAACATGCCCTTTTGTCGAA
GATATTGTTCGACGACAAGTTGAGATTGCTGTGCTCAGAGATCCTCGAATGGCTGCTTCTCTCCTTCGATTGCATTTTCATGATTGCTTTGTTATG
GTATATCTATCTCGTTTCCATAAA
TATTTTTCTTCTTGTTGTAAACTTCTTTATAAGAATACAGTCTAAAATCTTCATTGATAAAATAGGGATGTGATGCATCGGTTCTTTTAGACAGCACTGACGAGATGGTGAGCGAAAAGC
AAGCGACTCCAAATTTAAACTCTCTTCGTGGCTTCAGTGTTATCGATAAGATAAAATACATATTGGAAGAAGCTTGTCCTTACACAGTGTCTTGTTCTGATATTTTGACCATTGCTGCTC
GTGATGCTGTTGTGCTC
GTACTAATCTCTCTTCATCTAATTTCATTTTAGAATACATTATTTTTTTTCTCTCCCTAAAATTAAAGTCAAAATCTTATTTTTTTTCTCTCCCTAAAATTAA
AGTCAAAATCTTACGTTAATATGTTAGCATAAATTAAATTATCTTTGTACTATATTCATAAGCATCTTCTTAAATATGGACTTAAAATTAGCTTAGTACATTGTCAATGCTACGTTTTGA
AGTTTTAACACATGTTTTTCGACTTTAATACAATATCATAGGCGTTGATGAAATATAAATTTAAAACATTCTTTGAAGTTTAGTATGATATGATACTGAGTGTATTTTTTATTTTTACTT
TGTGGAAAGAGAGGAGGACCCGAATGGGCAGTGTCATTGGGAAGGAAAGACTCCTTGAAAGCAAGCTTTGACGGTGCCAACAAATACATTCCTTCTCCCAATTCTTCCCTTGAGACCTTA
ATTGCTAACTTTCAACAACAAGGCCTCAACATTCAAGACTTGGTTGCTCTATCAG
GTAGGTCAAGACCTGTTTTGTTCAACTTTTTTCATGTATTTAATTTTGGACATAAGTCATTTTTT
AGTCAATCAAAGAACTTATATATAATAGTTTCATGATGGTCGTTATAATCTTTTAACTTTCATTATACTTTTCAAACAAAATTATGCTTCAATACACCCATGATATAGATGCCTAAATTT
ATCTCTTGTTTAAAAAATATTCATATTTAAGTTCCTTAGAATGTTGTATAAAAGTTTTGCATTACATGAAACAAAGTGGCTATCCCAATTTCCACACATCCCCACATTGTTCTATGAACC
ATTTTCCATTCAACATTCTAATTGATTTCTACTTCACAATTAGTTTTGAAATTTTTACAACAAAGTGTTTCTTAACCTAAAAAATCGATAAACCAATATAATTGTTTCATGCACTAACAT
CTACAAGTGTTTTACTGTGAAAAGGAAGCCACACCATAGGGAAAGCAAGATGCTTGAGTTTTAGACAAAGAGTATATGAAATGAATGGAGGAGAAGAAGAAGAAGATAGATACAAGAGAT
ACAATACATATAAAAGAACTCTAAGGTCAATTTGCCCTAAAACAGGACAAGATCAAAGGGTTGCACCCTTAGATTTTAGGACACCAGCAAGATTTGACAACCATTACTTCCTCAACATTC
TTGAAGGCAAAGGGCTCTTAGGGTCTGATGATGTGCTCATAACCCAAGATTATGAAGGTGAAATTAGAACACAAGTTAGGAGCTATGCTTCTGATCAAACCCTTTTCTTTGATTCATTTG
TTAAGTCCATTGTTAAGATGGGGAATATCAATGTTCTCACTTCTCATGAAGGTGAAGTAAGAAGGAATTGTAGGTTTATCAATCACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGATTTTGAAGATATTGGTGGTGGTAATATTTGGTGTTGTTTTGCATGGAATTGAAAGTTCAGGGGAAGGACTTTTGGTTTTTGACTATTACAAAGAAACATGCCCTTTTGTCGAA
GATATTGTTCGACGACAAGTTGAGATTGCTGTGCTCAGAGATCCTCGAATGGCTGCTTCTCTCCTTCGATTGCATTTTCATGATTGCTTTGTTATG
GGATGTGATGCATCGGTTCTTTTA
GACAGCACTGACGAGATGGTGAGCGAAAAGCAAGCGACTCCAAATTTAAACTCTCTTCGTGGCTTCAGTGTTATCGATAAGATAAAATACATATTGGAAGAAGCTTGTCCTTACACAGTG
TCTTGTTCTGATATTTTGACCATTGCTGCTCGTGATGCTGTTGTGCTC
AGAGGAGGACCCGAATGGGCAGTGTCATTGGGAAGGAAAGACTCCTTGAAAGCAAGCTTTGACGGTGCCAAC
AAATACATTCCTTCTCCCAATTCTTCCCTTGAGACCTTAATTGCTAACTTTCAACAACAAGGCCTCAACATTCAAGACTTGGTTGCTCTATCAG
GAAGCCACACCATAGGGAAAGCAAGA
TGCTTGAGTTTTAGACAAAGAGTATATGAAATGAATGGAGGAGAAGAAGAAGAAGATAGATACAAGAGATACAATACATATAAAAGAACTCTAAGGTCAATTTGCCCTAAAACAGGACAA
GATCAAAGGGTTGCACCCTTAGATTTTAGGACACCAGCAAGATTTGACAACCATTACTTCCTCAACATTCTTGAAGGCAAAGGGCTCTTAGGGTCTGATGATGTGCTCATAACCCAAGAT
TATGAAGGTGAAATTAGAACACAAGTTAGGAGCTATGCTTCTGATCAAACCCTTTTCTTTGATTCATTTGTTAAGTCCATTGTTAAGATGGGGAATATCAATGTTCTCACTTCTCATGAA
GGTGAAGTAAGAAGGAATTGTAGGTTTATCAATCACTAG

Retrieve as FASTA