Entry information : CsaPrx90 ( Cucsa.326110.1)
Entry ID 8857
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2011-12-08 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-27 (Christophe Dunand)
Peroxidase information: CsaPrx90 ( Cucsa.326110.1)
Name (synonym) CsaPrx90 ( Cucsa.326110.1)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx90
start..stop
S start..stop
GmPrx328 504 0 6..322 4..320
GmPrx158 502 0 6..322 4..320
LjPrx30 502 0 6..322 5..322
NnPrx73 496 5.64e-179 6..322 8..321
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8857' 'complement(join(362482..362870,363083..363248,363401..363592,363711..363929))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 363711..363929 217 N° 2 363401..363592 190 N° 3 363083..363248 164 N° 4 362482..362870 387
complement(join(362482..362870,363083..363248,363401..363592,363711..363929))


exon

Literature and cross-references CsaPrx90 ( Cucsa.326110.1)
DNA ref. Phytozome 12:   scaffold03132 (363929..362482)
Protein sequence: CsaPrx90 ( Cucsa.326110.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (296)
PWM (Da):   %s   34006.88 (31225.3) Transmb domain:   %s   i9-31o
PI (pH):   %s   8.39 (8.39) Peptide Signal:   %s   cut: 27 range:27-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MADLGFKTVLILTLGFFLLFLGNVSAQLSTGFYSSSCPNLLSTVK
SSVRSAVSSEARMGASILRLFFHDCFVN
GCDGSILLDDTSSFTGEKNANPNRNSARGFDVIDNIKTAVEKACPGVVSCADILAIAARDSVVLLGGPSWNVKLGRRDSTTASQSQANNDIPGPTSSLSQLSSRFSALGLSSTDLVALSG
GHTIGQARCTTFRSRIYSNSSNIESSFARTRQSNCPNTSGTGDNNLAPLDFTPTSFDNNYYKNLVQNKGLLQSDQVLFNGGSTDSVVQNYANAPARFLSDFAAAMVKMGDIAPLTGSNGQ
IRKNCRMV

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGATTTAGGATTCAAAACAGTTTTGATTTTGACTTTGGGTTTCTTTTTGCTCTTTTTGGGCAATGTATCAGCTCAACTTTCTACTGGTTTTTACTCTTCTTCTTGTCCAAATTTG
TTGTCCACTGTCAAATCCTCTGTTCGTTCTGCTGTCTCAAGTGAAGCTCGCATGGGAGCTTCAATTCTTCGCTTGTTTTTTCATGATTGTTTCGTCAAT
GTACTTTTCTTTCATAAAACC
CTTCTTCTTCTTTTTTTTTTTTGTTTTGTTTCAAACTATTAAGTTTGGGTTCTTTTTCCCCTGCTTTTAATTATCATTTGTTTTGTTTGGAGTTTAGGGGGTTGCGACGGGTCAATTTTG
TTAGACGACACGTCGAGCTTTACCGGAGAGAAAAATGCTAATCCTAACAGAAATTCTGCTAGAGGCTTTGATGTTATTGATAACATCAAAACTGCTGTTGAAAAAGCTTGTCCTGGTGTT
GTTTCTTGCGCTGATATTCTCGCTATTGCTGCTCGTGATTCTGTCGTTCTC
GTAAGTCGTCATAGTTTTAACTTGATTTATATAATAAAATTAGTAATCTTTCTAATTTGATTAAACTAA
ACAAATATTGAAACTAGATTCAATGGAAATAAATCTTAAGTATAAGACTTGAAGTGATAATTTGAGTTTTGTGACAAATGTAGCTCTAGGAGGGCCGAGTTGGAATGTGAAGTTGGGAAG
AAGAGACTCTACAACTGCGAGCCAATCCCAAGCGAACAATGACATCCCCGGGCCAACTTCAAGTCTTAGCCAACTCAGCTCTAGATTTAGTGCTCTTGGACTTTCCAGTACTGACTTGGT
CGCTCTTTCAG
GTTCATATTTATTTTTCTGTACTTTTGACTTTCATTCATTCTACTTCAAGTCAACATATTTAAAGAAAAAAAAAACTCTTTGATCAACAAACGAATTAAAATTGTTGCT
CTTAAAAGTAGAGAGATCTAAAACTAAACTTATGAAGTAAAATGAACAAAAAGTGAGATTACAAGAACTAATTATGACGGTCACATTGAATAATTGATGTTAGGCGCGGACACACAATTG
GACAAGCGCGTTGCACAACATTTAGAAGCAGAATATACAGTAACAGCTCAAACATTGAGAGTTCATTTGCAAGAACAAGGCAAAGCAACTGCCCCAACACCTCAGGAACTGGAGACAATA
ATTTGGCTCCTTTGGATTTTACTCCAACCTCATTTGATAACAACTACTACAAGAATCTTGTTCAAAACAAGGGCCTCTTACAATCTGATCAAGTTCTCTTCAACGGCGGATCTACCGATT
CCGTTGTTCAAAATTACGCGAATGCTCCTGCCCGTTTCTTATCTGATTTTGCTGCCGCCATGGTCAAGATGGGAGACATCGCTCCTCTTACTGGCTCCAATGGTCAAATTAGGAAGAACT
GCAGGATGGTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGATTTAGGATTCAAAACAGTTTTGATTTTGACTTTGGGTTTCTTTTTGCTCTTTTTGGGCAATGTATCAGCTCAACTTTCTACTGGTTTTTACTCTTCTTCTTGTCCAAATTTG
TTGTCCACTGTCAAATCCTCTGTTCGTTCTGCTGTCTCAAGTGAAGCTCGCATGGGAGCTTCAATTCTTCGCTTGTTTTTTCATGATTGTTTCGTCAAT
GGTTGCGACGGGTCAATTTTG
TTAGACGACACGTCGAGCTTTACCGGAGAGAAAAATGCTAATCCTAACAGAAATTCTGCTAGAGGCTTTGATGTTATTGATAACATCAAAACTGCTGTTGAAAAAGCTTGTCCTGGTGTT
GTTTCTTGCGCTGATATTCTCGCTATTGCTGCTCGTGATTCTGTCGTTCTC
CTAGGAGGGCCGAGTTGGAATGTGAAGTTGGGAAGAAGAGACTCTACAACTGCGAGCCAATCCCAAGCG
AACAATGACATCCCCGGGCCAACTTCAAGTCTTAGCCAACTCAGCTCTAGATTTAGTGCTCTTGGACTTTCCAGTACTGACTTGGTCGCTCTTTCAG
GCGGACACACAATTGGACAAGCG
CGTTGCACAACATTTAGAAGCAGAATATACAGTAACAGCTCAAACATTGAGAGTTCATTTGCAAGAACAAGGCAAAGCAACTGCCCCAACACCTCAGGAACTGGAGACAATAATTTGGCT
CCTTTGGATTTTACTCCAACCTCATTTGATAACAACTACTACAAGAATCTTGTTCAAAACAAGGGCCTCTTACAATCTGATCAAGTTCTCTTCAACGGCGGATCTACCGATTCCGTTGTT
CAAAATTACGCGAATGCTCCTGCCCGTTTCTTATCTGATTTTGCTGCCGCCATGGTCAAGATGGGAGACATCGCTCCTCTTACTGGCTCCAATGGTCAAATTAGGAAGAACTGCAGGATG
GTTAAT

Retrieve as FASTA