Entry information : CsaPrx92 ( Cucsa.345800.1)
Entry ID 8858
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2016-01-27 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-27 (Achraf Jemmat)
Peroxidase information: CsaPrx92 ( Cucsa.345800.1)
Name (synonym) CsaPrx92 ( Cucsa.345800.1)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx92
start..stop
S start..stop
GhPrx05 444 3.48e-158 10..324 7..323
VvPrx12 442 2.42e-157 1..324 2..328
NnPrx10 441 2.45e-157 8..324 3..320
GmPrx172 441 4.33e-157 5..324 3..324
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8858' 'complement(join(81921..82339,86422..86584,86743..86925,87016..87225))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 87016..87225 208 N° 2 86743..86925 181 N° 3 86422..86584 161 N° 4 81921..82339 417
complement(join(81921..82339,86422..86584,86743..86925,87016..87225))


exon

Literature and cross-references CsaPrx92 ( Cucsa.345800.1)
DNA ref. Phytozome 12:   scaffold03443 (87225..81924)
Protein sequence: CsaPrx92 ( Cucsa.345800.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (301)
PWM (Da):   %s   34876.72 (32385.3)  
PI (pH):   %s   6.5 (6.14) Peptide Signal:   %s   cut: 24 range:24-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKLMILLNLLLFLGCFASISQAQLKFGFYARSCPTAKSIVRSVV
NDAIRNDATMAAVLLRLHFHDCFVE
GCDGSILVDNGARSEKLAFGHQGVRGFDVIEKAKRELEAQCPGLVSCSDIVAMAARDAIVTANGPDYDIPTGRRDGRVSDVSLASDLPDVSDSIDVLKRKFAEKGMNEKDLVLLSAAHTI
GTTACFFMTNRLYNFPGGGSDPNINPALLPELQSQCPRNGDVNVRLGIDRDTPRTFDISIFQNIRSGFAVLASDASLNNDPSTRAILDSYLSPLAPVLGPSFQRDFVTSIVRMGQIGTKT
GSEGEIRRVCSAFN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAAGTTGATGATTCTTCTCAATCTCTTGTTATTCCTTGGTTGCTTTGCTTCCATTTCTCAAGCCCAATTGAAATTTGGATTCTATGCTCGATCTTGTCCTACCGCCAAATCCATT
GTCCGTTCCGTTGTGAACGACGCCATTCGAAATGATGCCACCATGGCTGCTGTATTGCTCCGCCTCCATTTTCACGATTGCTTTGTAGAG
GTAACTCTCAAAAAAAAAAAAAAATGCGCA
CTTTTCTTTTGAAAGTCAATCCAACCCAAACAAATTATCATGCAATAACTTGATTTACAGGGGGTTGTGATGGTTCGATCTTGGTCGACAATGGGGCAAGGTCTGAGAAACTTGCTTTCG
GGCATCAAGGGGTGCGGGGGTTTGATGTAATAGAAAAAGCCAAGAGAGAATTGGAAGCACAGTGTCCTGGACTTGTTTCTTGTTCTGACATCGTAGCTATGGCTGCTAGAGATGCCATTG
TTACG
GTAATAAACTATTTTCGTTTTACATAATTTGAACCACCAACTTTTAGAACTTCCACGCACATTGATATCCGTTGAGCTAAGCTCTTACTTATCATCGTGTTCATCGTTATATATA
TATATATTGACAGTTTCTGAATAGTTTTGGAGAATTATGACAGGCGCAAATGGCCCGGACTATGATATTCCAACCGGCCGGAGAGACGGTAGAGTTTCGGATGTATCTCTGGCGAGTGAT
CTGCCGGATGTGAGTGATTCAATTGACGTTTTGAAGAGGAAATTTGCAGAGAAAGGGATGAATGAAAAGGACTTGGTTTTACTATCAG
GTACACACACATACACACACACTCATCTCTCT
CTCTCTCTCTCATGCACGTTTGGTGATATTAAGGTGGTTGGAAAGCCAACACAAATGAGTTTACTTTCCCTACCTCATTCAATAATCATCATCATCATCATACTTTTCTTTTTTCATTAC
TCCTTTGTTGGAAAATATATATATACACACACATAATATTTCCTAATAACTGAGGTAATTCAGTCAAGGTTAACCTACTTAAGTTAGTTCTTCTACATTTATTGGTATGATAGGTAGAAT
CTAAAAATAATGATGTGAAGTACACTAGATTATTAGTTAATGATGTGTTAAATAATTATAAATAAGAATAGTAAATATAACCATTCATCTAATTAATTAAACTTATTACTTGTTAATTGA
TTTATTTATAGAAGTTATATTTTTTTGGGTAATGAAGGAGACTACGGTTTTTCAATATAATATTAATATTGGATAGAGGAACGAGAATGACATGAATGATAAAATTTTTCAAAAGAAAAT
ACTCAAGTGTTATTTGGTCGTATCTTTTTTAATACGAAGAAAAGAGTAAGATATTGAGGCTAACTATAGCCTCGACTAAATTTAATTGTACTAACAAATTACTCCATTAGTCTTTATTTT
ATATTAGATTTTCTATTTTTTTTTTTATCATTTGCTATGATTTTGATAAAGAATATAAATGGAAGAAAAAAGAACTAGGTTTGTCAAACTTCTAAACATTGAAGAGGGCACATAAATGGC
AAAACCAAAACCTACTTTTCCATTTATGATTGGGAAGCCATGTTAGGTCCAACTACAGGAGATATATATATATATATATATATATATTATTTGAGATGTCAAACTAATTTTCCCAAAGGC
CAATAGGACCATACAAATGGGCACCATCACATAATGTACTTTGAAAGGGAATGGATGATTCACATTTCCTACTTTTATGTGCTTTAATAAGTTATTGCATTTAGGAATAGGGATTCTAAA
CTATTCATCATTTACCTAAGATATCATACAATTTAAGAATGATCTTAAGTATATTATCTTTAATTTAATCAAAACCTGCCTTTTCTATTTAAACTAATTATGGTTATTTTATTTCCTTGT
CCGATTTTAAACTTTTCAATTTTGTGTTTTAGTCGTTTTCAAAATTCAAATGGTAGATTTAAAAACGGTGATGTGAATGACTTAGAAAACTATAAACCTCATTTGAGAATTCAATTTATA
ATAGTGTAGTTTGACAATTTTTTTAATTAATAACTAAATTTTGGTTTGGATATTGAAAATATATATAGAATGTTTGTATAAAAAAATTTATAGTATTATAAGTTTATTTTCTAAAAACCA
AACAATTAGTAAGGGAGAATTAGAATTAAACTCACTAATTTAAATTAAAGATATAAATATTAGATTTCATTTTAATCCTTATTAATCTTTCCTCTTTGAAAAATTGATTTAATTATTGAT
TAGTTTATCTAACCATTTTAAATATTTTTTGTTTTTACCCTTGACTATAAAAACACAATTCTGAGGATTATAGTTATTAATTAATTTATACCATATCCTACTATTTTTAAACACTTGAGA
AAGCCTCCTCTATATTAATTTATTTGATGAGTAGGTGTTTAATTCCATAGCCAACATTTAAAGCCATGTGCTCTGCAATCTACAAAGTGATAAGTTTTGAACAATGTTTTTGTTAAATTA
TTAATGAAAATTAATAACAGTAACATTGATAAATAATAGAATATTCTCAAATTGAAAAATATTTGGATGTATCCTACAATCCATCCAAATGGTACAAATTCTTCTTTATTAAAAAATATA
TGAAAAAATCATCCAGTTACACCAAATATTACTATTAAAAAAAAAATGAAAGACAATAATACCAATAAATTTAATTTGATCTTTTTATTTTCCAAGTTTTTGAAAAACCAATGTTTACAA
GTAATGAATGCACGTAATGTCATGTTTATTAAGAAGAGAAGTTGCTTTCTTTTCTTCTAAACCACTCAAAATTTTAGAAAATTGAAAGATAAATATCATATAATTAATTATATATGTACA
TCTAATTGCATAAAGTTGTGAAAGCTAAGGTTGAAAGGGGCATGATATTTGTGAATATTGCAATAATATATGCAAAACCCACCATATCTTTTTGCTTCACAATTTAATATAAACCAATAC
CACTTGCCAAACTTGAGGCAAACCTTAGGTTAATCAGTAACCATATATAATAATAATATAAGAAAGAAAGAAAGAAAGAAAAACAGCTGTGTTATATTCATGTCACATGGGGTTCTCTAA
ATCAATCACGGATTTACATTTTGCTAATTTCTTGTAACATAAGGTTGTCATAATTTTGGATTTTTGCTGTGCTTTTCTTTCTTTTGGTAAATGTGAATGTAGCTTAGACGACTTAGGACA
GTGCCAAAAATGTATTAAAAAAGACTTGAAAGTTGCCTCTTAGAAAGGCCAATCTTAGATGGCCCGAATCTCTAAGTCACATAAATTGATAAACATTCGTCTTCTTTGTTCTGAAGCATT
TCTTTTTTAATACTCATAGTTTAGTTTCCATCATATACATATATATGTTTTCAAATGTGATATTATTATAATGTAATGAAAATGGGGAAATGTTTTAAATGACTTACTCTTATACGACAC
GTCTCGTGACTACATGAGACTATAGGATTAAGCCACTTGATCCACTTTTGGTCTCTCTCTTTACACACATTTATTGATTAGGTTAGGAGATTTGTGCATTTGAACTAAAGCCATAACTTT
ATAAAGTTTTTTTTTGTGTTTGAGAATTCACACCTTTACCTATCATGCTTGATTAAGTTGGAAGTTGAGAATTTGTGTCTTTGTTAAATAGGAACCTTCATTGAAATGACAATTTAATGA
ATGAAGTTGGTAGTAATTTTTTTTTTTTTGTAATTTTAAATTTGTGAATAAATCAAACGGGAGTTTGCAAAAATAGTACATTTTTTTAATGATAATGAAGTCAATATTACTTACATTTTC
AAAATTGAAAAAGTAGCAAATCTAAACGTGTCATACTATCGTCTAATTATTGTCATATTTGTCAAATTTGCAATATGAAAAAAAAAATGTTATGAACTGTTTTTTCTAATTTTTTTTGTT
ATCTAATGCAATTTTTCTAAATTAAACTATGACTTTAATAATAAGTAATAATTTAGTTATATTACGTTTTATAATTTATTATGGTTTAGTTTTTACTATAACACTTATCATCAAATTTGT
TTTTAGAAAATGATACTTTTGAGTCGATAGGTGCACCCATTTTCATTAGATAGTCATTATTTTAGTACCTTCGTTATTTTCACCAAATATATTCGATAAACACGTATAAAACAAAGTAGT
TCAATTAAAAAAAGCCAGAGAGAAGTTCAACATAGAGAAGAAATCAAATAAAAGCATTAATAATTTATTAACAACTAATTTTTTTTGTCTGTAGGAGAGCTTTAATTACTAAAAGTTTGT
TTTGTTTTTTAATCTTTTGTGTTTAATTGTAACTTTGAAATTTAAGATTACTGTGTTATTTGTGTGCATGGTTGATGAGTCATCCGTTTGTAAAGAATAAACGATTTATTGTTTGACATA
GATAATCTCTTTTGGGGACTAATTATCAATACAAGTAAAAAGTGAATAATCTTTCGCCAAACAAGAGTCATAGGAAGATATTGTCTCTTCCAATTGAACTACTAACCACGTCGAGAGTTG
TTGCATGCCTACTCTTAGTCCAATGTCATATATTGACGTTGACGAGTGGAGTTAGCTAGATATCTAAAGTTAAAATAACAAAAATAACTCTCGACGCCCTAGGTTAGGGACCGCATATAT
TCTAGACCAATCTCCTGTTTAAAGTAAGAGCATGTGATTCGAAATTAAGAAGTTGGTCCAACATGTGTTTTTAACCTAATATGTAATATTTAATTTACAATATCTTCAATGTATCCATCC
TTCATTACTTTTATTTTTACATAGTGTCATTGAAATCTTTGGGGAAAAAGTTCATTTTCTATCGTATAATCTTCTCTAAAACCCCCACAGCTCTGCCCATACAATCGGAACCACTGCATG
CTTCTTCATGACAAATCGCCTCTACAACTTCCCGGGCGGCGGATCAGACCCAAACATAAACCCGGCGCTGCTACCGGAGCTACAGTCGCAATGTCCTAGAAATGGCGACGTCAATGTTCG
ACTTGGCATCGACCGTGACACTCCCCGCACATTCGACATCAGCATTTTTCAAAACATAAGAAGCGGCTTTGCCGTCCTCGCCTCCGATGCTAGTCTAAACAACGACCCATCGACCCGAGC
CATATTGGACTCGTACCTTAGCCCTCTCGCCCCCGTTCTTGGCCCCTCATTTCAACGTGATTTTGTTACCTCCATTGTGAGAATGGGGCAGATTGGGACTAAAACTGGCTCTGAAGGAGA
GATTCGAAGGGTTTGTTCTGCTTTTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAAGTTGATGATTCTTCTCAATCTCTTGTTATTCCTTGGTTGCTTTGCTTCCATTTCTCAAGCCCAATTGAAATTTGGATTCTATGCTCGATCTTGTCCTACCGCCAAATCCATT
GTCCGTTCCGTTGTGAACGACGCCATTCGAAATGATGCCACCATGGCTGCTGTATTGCTCCGCCTCCATTTTCACGATTGCTTTGTAGAG
GGTTGTGATGGTTCGATCTTGGTCGACAAT
GGGGCAAGGTCTGAGAAACTTGCTTTCGGGCATCAAGGGGTGCGGGGGTTTGATGTAATAGAAAAAGCCAAGAGAGAATTGGAAGCACAGTGTCCTGGACTTGTTTCTTGTTCTGACATC
GTAGCTATGGCTGCTAGAGATGCCATTGTTACG
GCAAATGGCCCGGACTATGATATTCCAACCGGCCGGAGAGACGGTAGAGTTTCGGATGTATCTCTGGCGAGTGATCTGCCGGATGTG
AGTGATTCAATTGACGTTTTGAAGAGGAAATTTGCAGAGAAAGGGATGAATGAAAAGGACTTGGTTTTACTATCAG
CTGCCCATACAATCGGAACCACTGCATGCTTCTTCATGACAAAT
CGCCTCTACAACTTCCCGGGCGGCGGATCAGACCCAAACATAAACCCGGCGCTGCTACCGGAGCTACAGTCGCAATGTCCTAGAAATGGCGACGTCAATGTTCGACTTGGCATCGACCGT
GACACTCCCCGCACATTCGACATCAGCATTTTTCAAAACATAAGAAGCGGCTTTGCCGTCCTCGCCTCCGATGCTAGTCTAAACAACGACCCATCGACCCGAGCCATATTGGACTCGTAC
CTTAGCCCTCTCGCCCCCGTTCTTGGCCCCTCATTTCAACGTGATTTTGTTACCTCCATTGTGAGAATGGGGCAGATTGGGACTAAAACTGGCTCTGAAGGAGAGATTCGAAGGGTTTGT
TCTGCTTTTAACTAA

Retrieve as FASTA