Entry information : CsaPrx94 ( Cucsa.362070.1)
Entry ID 8859
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2016-01-27 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-27 (Achraf Jemmat)
Peroxidase information: CsaPrx94 ( Cucsa.362070.1)
Name (synonym) CsaPrx94 ( Cucsa.362070.1)
Class Class III peroxidase    [Orthogroup: Prx034]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx94
start..stop
S start..stop
CmPrx94 625 0 1..337 1..340
GrPrx02 440 4.04e-156 2..337 1..337
PtPrx37 434 7.16e-154 2..337 1..336
MePrx124 434 9.39e-154 2..337 1..338
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8859' 'complement(join(67312..67730,68057..68216,68333..68512,68983..69237))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 68983..69237 253 N° 2 68333..68512 178 N° 3 68057..68216 158 N° 4 67312..67730 417
complement(join(67312..67730,68057..68216,68333..68512,68983..69237))


exon

Literature and cross-references CsaPrx94 ( Cucsa.362070.1)
DNA ref. Phytozome 12:   scaffold03611 (69237..67315)
Protein sequence: CsaPrx94 ( Cucsa.362070.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (310)
PWM (Da):   %s   37795.41 (34761.8)  
PI (pH):   %s   9.18 (8.84) Peptide Signal:   %s   cut: 28 range:28-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMRERRKCMIVSLVGITLMSLCILAKGENTLQPPVKLIWHYYKLN
TTCPDAEEYIKHQVKLFWQEDKSITAKFLRLLSADCLSKN
GCDGSILLDGPNSEKNAPQNKGLKGFKEIDKIKSVLEDRCPGVVSCADILNLATRDAAHLAGAPSYPVYTGRRDGFTSSIDAVDLPSPSISLQQGLQYFESKGLDVLDMATLLAGHSMGE
THCRYIKDRLYNFNGTKKADPSMNKSLLKDLRNKCPKNSKKDPTVNLTPKPENDYQFTGLYYSRILSKKAVLGIDQQLIFSDETKEIIQEFAPKSGFEDFRRSFALSMSRMGNIKVLTGK
DGEIRRDCRRRN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Containing motif 'SADC'. This motif also can be found in CmPrx94 (Cucumis melo).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGAGAGAGAAGAAAGTGTATGATTGTATCCCTTGTGGGCATAACACTGATGAGTTTATGCATTCTTGCGAAAGGTGAAAATACATTACAACCACCAGTTAAGCTAATATGGCAT
TACTACAAACTCAACACAACTTGTCCAGATGCTGAGGAATACATAAAACATCAGGTCAAATTGTTTTGGCAAGAGGATAAAAGCATTACTGCCAAGTTCCTTCGTTTGCTCTCTGCAGAT
TGCCTTTCCAAAAAT
GTACTATAACTCTTCTCCTTCTTCTTCCATCTCTCTCTCTCTTTTTCCTATACTATTCGTTTCATTCGATCTAATGTTTTGTTTGTTTGGACTGAATCCATCCGT
CTAAATATTTAAGAATATACGTACATGTTTGTTGTTTGTAGTTTCTTATTTCTTATTCATAAAATTATTGTAGTTAAACGTTATATTAATTTTATCTTCGTCCATTGTGATTTAAAATGG
TATCAGTAGGTGGTTGTCTAGAAAAGTTTTATGTTCAACTCCTTGCGTCTGTGATTTATATTCAAACTGTCATTTTCTTGGCTCTTCTTCATACAATAAGTTAATTGAGGAGGAGGAGGA
GGAGTAGGGTTAGAAATTATATTAGATTTGTTTTTGCTTATTAGTTTTAAACCTTTGGATTGATGGGTGATTCAAAGGATGATGTAAAAGATAAATATTGATGTATATTTGATTACTTAA
TACAGGGGGTTGTGATGGCTCAATTCTTCTTGATGGTCCAAACTCGGAGAAAAATGCACCACAAAACAAAGGCCTCAAAGGGTTTAAAGAAATTGATAAGATCAAAAGTGTACTCGAAGA
CAGATGTCCGGGTGTTGTTTCTTGTGCAGATATTTTGAACCTGGCCACTAGAGATGCTGCCCATTTG
GTATTCAATACTTCTATCGATTTTGTGGAGACGACTTTGACATTTTCCTATAT
TTAAATATATTTACAATAGTTTTGTTATTTAAAATAAATTGACGGTAGACTGATTGGATGCAGGCGCAGGTGCGCCATCTTATCCTGTTTATACAGGAAGGAGGGATGGTTTTACAAGCA
GTATTGATGCAGTGGATTTGCCATCTCCCTCCATATCATTGCAACAAGGCCTTCAATATTTCGAATCTAAAGGTCTTGATGTTTTGGACATGGCAACATTGCTAG
GTAAGTGACACATTC
TACACATACGCTCCCTCCTATTATAGTTTTCTATTTTTGAAATTTATGTTTCTTTAAAAAAATTATCAGCAATTTTCGAAAACAATTTGATTTGTCGTAGTTTTCAACTTTAGATTTTAT
TTTGGTTGAACTTGTTTACTTAGATCAAAATTTTATTTTATACTCCTAAAGAAACAACAAAATCGCTTGGAAAACCACTGATCCAATTTTATTATCTATTAAGAACATAACTGAAAAGAA
AAGAAAAAACTTGTGTTAATTATATTATTTTTGAATTCTTGATAACATTTTACATTGTTTAATCATATCAGCTCTGGACATTCAATGGGAGAAACACACTGTCGATACATCAAGGATAGG
CTATACAATTTCAATGGCACAAAAAAGGCAGATCCATCAATGAACAAATCACTCTTAAAAGATCTTCGAAATAAATGCCCAAAAAATTCAAAAAAAGATCCAACAGTGAACCTAACACCA
AAACCTGAAAACGACTATCAATTCACAGGTCTTTACTACTCGAGAATCCTCTCCAAAAAGGCGGTACTCGGTATCGATCAACAGCTTATTTTTAGTGACGAAACGAAGGAAATCATCCAG
GAGTTTGCTCCAAAATCTGGATTTGAAGACTTCCGTCGGTCCTTTGCTTTGTCCATGAGTAGGATGGGAAACATCAAGGTTTTGACCGGAAAAGATGGCGAGATTCGACGAGATTGTCGG
AGAAGAAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGAGAGAGAAGAAAGTGTATGATTGTATCCCTTGTGGGCATAACACTGATGAGTTTATGCATTCTTGCGAAAGGTGAAAATACATTACAACCACCAGTTAAGCTAATATGGCAT
TACTACAAACTCAACACAACTTGTCCAGATGCTGAGGAATACATAAAACATCAGGTCAAATTGTTTTGGCAAGAGGATAAAAGCATTACTGCCAAGTTCCTTCGTTTGCTCTCTGCAGAT
TGCCTTTCCAAAAAT
GGTTGTGATGGCTCAATTCTTCTTGATGGTCCAAACTCGGAGAAAAATGCACCACAAAACAAAGGCCTCAAAGGGTTTAAAGAAATTGATAAGATCAAAAGTGTA
CTCGAAGACAGATGTCCGGGTGTTGTTTCTTGTGCAGATATTTTGAACCTGGCCACTAGAGATGCTGCCCATTTG
GCAGGTGCGCCATCTTATCCTGTTTATACAGGAAGGAGGGATGGT
TTTACAAGCAGTATTGATGCAGTGGATTTGCCATCTCCCTCCATATCATTGCAACAAGGCCTTCAATATTTCGAATCTAAAGGTCTTGATGTTTTGGACATGGCAACATTGCTAG
CTGGA
CATTCAATGGGAGAAACACACTGTCGATACATCAAGGATAGGCTATACAATTTCAATGGCACAAAAAAGGCAGATCCATCAATGAACAAATCACTCTTAAAAGATCTTCGAAATAAATGC
CCAAAAAATTCAAAAAAAGATCCAACAGTGAACCTAACACCAAAACCTGAAAACGACTATCAATTCACAGGTCTTTACTACTCGAGAATCCTCTCCAAAAAGGCGGTACTCGGTATCGAT
CAACAGCTTATTTTTAGTGACGAAACGAAGGAAATCATCCAGGAGTTTGCTCCAAAATCTGGATTTGAAGACTTCCGTCGGTCCTTTGCTTTGTCCATGAGTAGGATGGGAAACATCAAG
GTTTTGACCGGAAAAGATGGCGAGATTCGACGAGATTGTCGGAGAAGAAACTAG

Retrieve as FASTA