Entry information : SbPrx62 (Sobic.003G152100.1 [2.1] / SB03G013210 [1.4])
Entry ID 886
Creation 2006-01-03 (Christophe Dunand)
Last sequence changes 2006-01-03 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx62 (Sobic.003G152100.1 [2.1] / SB03G013210 [1.4])
Name (synonym) SbPrx62 (Sobic.003G152100.1 [2.1] / SB03G013210 [1.4])
Class Class III peroxidase    [Orthogroup: Prx098]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Leaves
Ovaries
Roots
Inducers Acid treatment
Alkaline treatment
Dark growth
Drought
Light growth
Oxidative stress
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx62
start..stop
S start..stop
ZmPrx49 614 0 6..357 1..355
BdiPrx66 517 0 6..357 1..355
TaPrx39-1A 489 3.74e-175 9..348 3..344
TmPrx08 489 6.05e-175 9..348 3..344
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '886' 'join(16173165..16173404,16176657..16177490)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16173165..16173404 238 N° 2 16176657..16177490 832  
join(16173165..16173404,16176657..16177490)


exon

Literature and cross-references SbPrx62 (Sobic.003G152100.1 [2.1] / SB03G013210 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_3 (16173165..16177490)
Cluster/Prediction ref. PlantGDB:   SbGSStuc11-12-04.30474.1
Protein sequence: SbPrx62 (Sobic.003G152100.1 [2.1] / SB03G013210 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   357 (324)
PWM (Da):   %s   37603.93 (34409.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.35 (6.03) Peptide Signal:   %s   cut: 34 range:34-357
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGERMSTSSGGFAGLVACVATVCLLLPTGSRAQLKVGFYNTTCP
NAEALVRQVVTAAFANNSGVAPGLIRLHFHDCFVR
GCDASVLLSVNPAGGNTERQSRANNPSLRGFDVIDAAKAAVERSCPRTVSCADIVAFAARDSVNLTGKLFYQVPAGRRDGRVSNETEADTNLLGPDSTAQVLIDGFRRKNLTVEDMVVLS
GSHTIGRSHCASFLATNRRRLADGTISAAYQALLEALCPPSPGQFDPNTTEIDVSTPAVLDNNYYKLLPLNLGLHFSDDQLIRNATLAPLANAFAADETLWKQKFAAAMVKMGNIDVKTG
TTDEIRLNCSVVNPSSSSAAAAGVIEMLFPADEVATS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, intron 1) and 17 ESTs (TC102790, 5'is missing) and from 12 EST (TC102791,sequence between FDN and Stop is missing, stop at position 283).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGGAGAGAGGATGAGCACTAGCAGCGGCGGCTTTGCCGGCCTGGTGGCGTGCGTCGCCACCGTGTGCCTGCTGCTGCCGACGGGGAGCCGCGCCCAGCTCAAGGTGGGGTTCTAC
AACACCACCTGCCCCAACGCCGAGGCGCTCGTGCGTCAGGTCGTCACGGCTGCTTTCGCCAACAACTCCGGCGTCGCACCCGGCCTCATCCGCCTCCATTTCCATGACTGCTTTGTCAGG
GGGTACGTACGTATATACACAATTAAACATGCATGCATGTAAGTGGTGTCTCGGCAGATCACACATGTGCAGTACATGTATAGACTCTACTTGATTTTTTTTCCACGTTTTTCATCTCTA
CTACTTCGTACTTCAGACGAGCTGGTTCACCCAATTCCATTGCCACGGTCGTTCAGTAGTTTTTAATCTAGCGAACAATCCGACAGCTAATGCATGCCGGTCGTCCATCCTTCTCCCACC
ACTTCTCTTTCCCTCTGCTTTTGACATCATCATGAAAAAAATAAAATATTTATTTCAAATTACTATAACTTTTGAATGATGTATCTATTTTTAATTCCGTCTTCACCGGTGTGTTCAACG
TGACAAGACGAACAAAACTAGACCCCACTTCTATATGTTTCGAGGATTTTTATTTTTCTAATAACAATTTATGTATATAAACTTATAACATATAAGTTATGTTGCTAACTTATTCTGCTA
AATTATGCTGCTAACCTATTCTGCTAAGTTGTATCGTATAACTTCTGTTTATGTATAATAAATGTCATAACTTTCTATATGCACTAGTGTATTAGTTGTGCAACTTATGTACATAAGTTG
TATTGTGTAACTTATGTCTCTCTCTATTCTAAATTATAAAATGTTTTGATATTTCTACATATATTGATTTTGTTATGTGTATACATATATAGTTGTGTCTAGATACATACTAAATTCAAT
TTAGAAAAGTCAACGTGCCTTATAATTCGAAATAGTGGAAGTAAACTTATGTACATAAGTTATATACTATAACTTTTTGAGAACGACTAAGTTAGCAATGTTAAGTTATTTCTCGAACTT
ATGTTGTCTAGAAGCACTTCTAAGTTAGTACTGTTAAGTTTATCGTGAAAGTTACGCTTTTTTTTAATTCCATTTTATAAGTTATGAGCACATGCTTCTTAAAAAAAATATATTAAAGGG
CGGGTGATCTAGGAAAAGAAAGTGAAAAGAGAATCGAATATCTAAAAAGAGAAAGAGAAACGATTCTTGTTCTGTCCAAAATAAAAAGTAATATATGCACTTTCCAAAAAAGGAAAGAAA
ATAGTTGTCGGAAACTGACCGCTGCTTTTATTTTCACTGAACGTTTGTGAAATAGTGGTGTCGGCTTGTTCATGAGAGATGGAAATATATCTCTCATATAATAATATTCGTCCTGTGAAC
AAGGAACCAAAAAGGAAATATAAGGTATAGCATGATCCAACAATAGTTGCGGTAAAACCAAACGTATTAATTTTGACCAATATATTGTAAAGTTAGACACATAAGAGGATGGGAATTCCA
AAAATAATTTTCAACTGAAATCCTCTTGGTATACTCTGTCAGACCAAATATATACAAAAAATTATTAATATTTATAGTACATAATAAATATCGTTAGATTAATTGTTCATATTTTGACAG
TAACCTTATTTGGAGATATAAATATTGCTAATGTTTTATATAACTGCCCATTTAGATCTTTATCATTCTGGAAAAATTATAATCTACTTTATGAACTAGGCTAGCTATTTGGCTAGCAAA
TTTGATATTCCACAACTTTCAAAGTTTAAATATAAACCTGTGTTAAATTCGTGGGTGAAAGATAGAGATAGATATTTCGTCAATTATCATGCCCTGTTTCTGCTTTGCATCTTATACCAA
GCAGAAGTGCGGTGTATAAGTATCTCCCCTCTGTGGCCAACAACAACATACAAATATGTTCCACACGCAGTCATGCTAACTTAACTGATTCGTGCCTAAATTGTGATTATTGGAACGGAT
TTTAATTCAAAAACTCAAATGAGACCTAATTCTTCTAGTTAAATTTAAGAAAGCTTGAATTATATACATAACCATAAACAGCATTTTTTGTGGTTTTTGGTATGGATGGCGTAGTGGTTG
CGGCTATTTATTTACAACCAAGTAAATATCTAAATTATTTAATTTGAACAATGGTGCAAAAACTCAAAAACGTTGGCCAATAACATATTTTCCTAAGGCCTTATTTAGATGTCCATGTGT
TTATCTCAAATTTTCAACCCATGTGTGTTGAAATGGGTTTGTGGGAAATTTAAACTAAACTCTATATACCAACCCACCTCAACGCATACGTCTGAGATGAATACATAGATACCCAAACTA
AGCCCCTAACATGGTCTTCAACATATTGTGAGCCAGAGATTTTTACGTAAAACACTACCAAAATGGTAAAAATCTCCTAGTATTTTTAACTAGTAATAAAACACTATCATTAGTCATATC
ACATACGAATCTCACTAGGAGACATTTAGTAGGCAAATTTATACTAAATTTTGAATACCAAAACACTAGAAGAATCCCACGTTACTAGGAAAAATCTAAAATTATGGTTGTGAAAGTTCC
ATCAATAATAATAATTTAGTCTGTTCGATCAGTGTAGGTAACAGATAAGGGTTGTTTGTCTCTATCATAAAAATAATCCAAACAAAACTCTAAGCTTCACGGAACACGTGCACATGTCTT
GGTTATCGTTCTCAAACTTTCCTCTCTTGAATAATAGATAGTTCAACAGCAACGAAAGCTCAGTTTGGATCTTGGCAGCATATGCTCCCTCAACTCTTGAATTATATTCTTCATGGATAT
ATATGACATAAACCGTTGAATTATTTTGGAAGAACAAGTCAATTGGTCGTTGGTACACACATAGTACATGAGTACAACCACCACCTAGATAGACCGGCCTGTACTAGCAATATATTGATG
CCGTCCAACAGGTACTATATACTACAATTACGTAGGAGTACTAGTTAAGATTGGTATTAGGCCTTGTTTAGATGCACTAAAAAACCCAAAACTTTATAAGATTCTCCATCACATCGAATC
TTACGGCACTTGCATGGAATATTAAATATAGATAAAAAAAATAACTAATTGCATAGTTTATCTGTAAATCACGATACGAATCTTTTCAGGCTAGTTACTCTATAATTGGACAATGTTTGT
TAAATAAAAACGAAAGTGCTATAGTGTCAAAATCCAAAAAGTTTTTTATTAAAAAAGGCCTTATCCAACGCACTTGTGGTTTTATATACTGCCAGTCCAAGTCCAGAATGATCAGCGTTG
AAGCATACGCGTGTTATGTTGATGCTTGACAATTAATGTAATGCCACATTTACTAATCATGGTGAGGACTGAAACAGTGAAACCTAATTAAACTTTGGTGGTTGGCTTTTGATGACCCAT
CATTCCACACACAGGGCTGCGACGCCTCCGTCCTCCTATCCGTGAACCCCGCCGGCGGCAACACGGAGCGTCAGTCCCGGGCGAACAACCCGAGCCTGCGCGGCTTCGACGTGATCGACG
CCGCCAAGGCCGCCGTGGAGCGGAGCTGCCCGCGCACCGTCTCGTGCGCCGACATCGTCGCCTTCGCCGCCCGCGACAGCGTCAACCTGACGGGCAAGCTCTTCTACCAGGTGCCCGCGG
GGCGGCGGGACGGCCGCGTGTCCAACGAGACGGAGGCCGACACCAACCTGCTTGGCCCTGACAGCACGGCGCAGGTCCTCATCGACGGCTTCAGGAGGAAGAACCTCACCGTCGAGGACA
TGGTGGTGCTGTCGGGCTCCCACACTATCGGCCGCTCCCACTGCGCCTCCTTCCTGGCCACCAACCGCCGCCGGCTGGCCGACGGGACCATCAGCGCGGCGTACCAGGCGCTGCTGGAGG
CGCTGTGCCCGCCCAGCCCCGGCCAGTTCGACCCAAACACGACGGAGATCGACGTCAGCACGCCGGCTGTGCTGGACAACAACTACTACAAGCTGCTGCCGCTCAACCTCGGCCTCCACT
TCTCCGACGACCAGCTCATCCGCAACGCCACGCTCGCGCCGCTCGCCAACGCCTTCGCCGCCGACGAGACGCTCTGGAAGCAGAAGTTCGCCGCCGCCATGGTCAAGATGGGCAACATCG
ACGTCAAGACCGGCACCACGGATGAGATCCGCCTCAACTGCAGCGTCGTCAACCCGTCCTCGTCGTCGGCGGCCGCCGCCGGGGTGATCGAGATGCTGTTCCCGGCCGACGAGGTTGCCA
CGAGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGGAGAGAGGATGAGCACTAGCAGCGGCGGCTTTGCCGGCCTGGTGGCGTGCGTCGCCACCGTGTGCCTGCTGCTGCCGACGGGGAGCCGCGCCCAGCTCAAGGTGGGGTTCTAC
AACACCACCTGCCCCAACGCCGAGGCGCTCGTGCGTCAGGTCGTCACGGCTGCTTTCGCCAACAACTCCGGCGTCGCACCCGGCCTCATCCGCCTCCATTTCCATGACTGCTTTGTCAGG
GGCTGCGACGCCTCCGTCCTCCTATCCGTGAACCCCGCCGGCGGCAACACGGAGCGTCAGTCCCGGGCGAACAACCCGAGCCTGCGCGGCTTCGACGTGATCGACGCCGCCAAGGCCGCC
GTGGAGCGGAGCTGCCCGCGCACCGTCTCGTGCGCCGACATCGTCGCCTTCGCCGCCCGCGACAGCGTCAACCTGACGGGCAAGCTCTTCTACCAGGTGCCCGCGGGGCGGCGGGACGGC
CGCGTGTCCAACGAGACGGAGGCCGACACCAACCTGCTTGGCCCTGACAGCACGGCGCAGGTCCTCATCGACGGCTTCAGGAGGAAGAACCTCACCGTCGAGGACATGGTGGTGCTGTCG
GGCTCCCACACTATCGGCCGCTCCCACTGCGCCTCCTTCCTGGCCACCAACCGCCGCCGGCTGGCCGACGGGACCATCAGCGCGGCGTACCAGGCGCTGCTGGAGGCGCTGTGCCCGCCC
AGCCCCGGCCAGTTCGACCCAAACACGACGGAGATCGACGTCAGCACGCCGGCTGTGCTGGACAACAACTACTACAAGCTGCTGCCGCTCAACCTCGGCCTCCACTTCTCCGACGACCAG
CTCATCCGCAACGCCACGCTCGCGCCGCTCGCCAACGCCTTCGCCGCCGACGAGACGCTCTGGAAGCAGAAGTTCGCCGCCGCCATGGTCAAGATGGGCAACATCGACGTCAAGACCGGC
ACCACGGATGAGATCCGCCTCAACTGCAGCGTCGTCAACCCGTCCTCGTCGTCGGCGGCCGCCGCCGGGGTGATCGAGATGCTGTTCCCGGCCGACGAGGTTGCCACGAGCTGA

Retrieve as FASTA