Entry information : CsaPrx95 ( Cucsa.363350.1)
Entry ID 8860
Creation 2011-06-29 (Qiang Li)
Last sequence changes 2016-02-15 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-15 (Achraf Jemmat)
Peroxidase information: CsaPrx95 ( Cucsa.363350.1)
Name (synonym) CsaPrx95 ( Cucsa.363350.1)
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx95
start..stop
S start..stop
EguPrx126 417 9.17e-148 23..323 25..323
EgrPrx126 417 1.85e-147 23..323 25..323
EglPrx126 414 3.31e-146 23..323 25..323
VvPrx59 412 1.55e-145 25..322 28..324
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8860' 'join(931532..931744,931929..932120,932260..932428,933123..933529)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 931532..931744 211 N° 2 931929..932120 190 N° 3 932260..932428 167 N° 4 933123..933529 405
join(931532..931744,931929..932120,932260..932428,933123..933529)


exon

Literature and cross-references CsaPrx95 ( Cucsa.363350.1)
DNA ref. Phytozome 12:   scaffold03611 (931532..933520)
Protein sequence: CsaPrx95 ( Cucsa.363350.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (300)
PWM (Da):   %s   35776.41 (33225.0) Transmb domain:   %s   i7-26o
PI (pH):   %s   9.15 (8.94) Peptide Signal:   %s   cut: 25 range:25-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRASNPIISVLLFTTLLALQVVNGALVNNFYRRTCPQAERIVQDVTFRLVRSNPRLGAQLLRLQFHDCFVRGCDASILLDTVGTNQSEKEARPNLSLLGFNEIDQIKSEVEKACSGVVSC
ADILALAARDAVSFPFKNRPRWPVLTGRRDGTISRSSEVSGNIPSPFSDFATLKQIFENKRLNVIDLVILSGGHTLGEAHCGTFSRRLYNFTGKGDADPSLDPRYADFLRTKCPNPADPS
ITVEMDPRSSRSFDSNYFKILTQHKGLFQSDAALLNDTSSSRLVRSLQNPKVFSFSFASSMLKMAAIEVLTGNNNGEIRKQCRF

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCTTCAAATCCCATCATTTCTGTACTGCTTTTCACTACTCTTCTTGCCCTTCAGGTTGTCAATGGAGCTTTGGTCAATAATTTCTATAGGAGAACCTGCCCTCAAGCTGAGAGA
ATCGTTCAAGATGTCACCTTCCGTCTCGTTCGATCCAATCCTAGACTCGGCGCACAGCTTCTTAGACTTCAATTTCATGATTGTTTCGTTCGG
GGGTATGAAAGAAATAGCTTTTTTTTT
TGTCGTTAACACGTTAAAATACATTTTTCAAGTAATTTTAAAAGTGAGGATGAAGGTAATTTTGGTCATTTTCGGAATCACTAATTCTTCGAACATGACATTAAAATAAAATATATATCA
TAATTAATTGGTTTGATATTTTTTTCATTTGTACTATAGGGATGTGATGCATCTATTCTATTAGATACGGTTGGAACAAATCAATCGGAGAAGGAAGCAAGGCCCAACCTATCACTATTA
GGGTTTAACGAAATTGACCAAATCAAGTCCGAGGTTGAGAAAGCTTGTAGTGGAGTTGTTTCTTGTGCTGATATTCTTGCTCTAGCTGCCCGTGATGCAGTTTCCTTTCCC
CCGTGAGTC
ACTTTCACACTCTCTCTCAATCCTCTTCATCTCTTATAACAAATTAAAATAATTGACGAAAAATATTGAGATCTCAAATAAATATATACTTAATAAATTTGCTCATTATTTCTTTATTAA
TTCATAAAACAGTTCAAAAATCGACCACGCTGGCCAGTCTTAACGGGAAGAAGAGATGGAACGATTTCACGATCATCAGAAGTTAGCGGCAATATCCCATCGCCGTTCTCCGACTTTGCC
ACTCTTAAGCAAATTTTCGAGAATAAAAGGCTAAATGTTATTGATCTAGTTATTTTATCAG
AGGTAAATAATTAAACACCTTGAAAACTCATATATAGATAATAATAATAATAGTAATAA
TTGAGTTAATAATATAATAATAAATTTATAGAATGAGAAAATATTAATTAAGAAGATTGAAAGAAAACAATTATGCATATTGTCGAACGTACGTCCAAAAGAAGGTGTAGTGCATGCATG
AAGATGTCTGAATCTCAAGTATTTGTTAATTTTTATTTTCAAATTAGAAAAAAAAGAAAAGAAAAAAAAAGTTAACGTATGGTTGGTAAATTTATATTAAAACTGGGGTGATTTATTTAC
AAAAACGACTTAAGTTAGACTCATTGATTCAATTATTTTCTATCAAATTATAACTTTTTTTCTAATTATTATTATATAATTATTTAAAACTTTATATATGATTGAATAAATTTAATCTGA
AAATTTCTGTGAAAATTTATATGTGTTTGTGGAAGAATAGAACTTGAATTAAAAAAGTGAGTAACGTTTGAGATTAGTTTATCTATAACGGGACTAATTTTACAAGAGAGATTATTTTAT
TATACTCTACTATACTATGTTTGAGTGTCAAGAAAATTCGTAGGGCATAAGTTTTTTATCCAAAAAAAAAAAATGATCACAAACTTGAACGAATAATTAAATATGTTCCATATCGAACTA
AGATTTAAAATAATGCTAATAATATTTTGGTATTTAGGTGGTCACACACTTGGAGAAGCTCATTGTGGCACTTTCTCAAGGAGGTTATACAACTTCACAGGCAAAGGAGACGCAGATCCT
TCATTAGATCCAAGATATGCAGATTTTCTTAGAACAAAGTGTCCAAATCCAGCTGATCCTTCCATTACAGTTGAAATGGATCCAAGAAGTTCTCGTTCTTTCGACTCCAACTATTTCAAA
ATTCTCACACAACATAAGGGTTTGTTTCAATCCGACGCTGCGCTTCTCAATGACACTTCCTCCTCCCGGCTCGTCAGGTCGTTGCAGAATCCAAAGGTTTTCTCTTTTAGCTTTGCTAGT
TCCATGTTGAAGATGGCAGCCATTGAAGTCCTCACTGGAAATAATAATGGTGAAATTAGGAAACAATGTCGTTTTGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCTTCAAATCCCATCATTTCTGTACTGCTTTTCACTACTCTTCTTGCCCTTCAGGTTGTCAATGGAGCTTTGGTCAATAATTTCTATAGGAGAACCTGCCCTCAAGCTGAGAGA
ATCGTTCAAGATGTCACCTTCCGTCTCGTTCGATCCAATCCTAGACTCGGCGCACAGCTTCTTAGACTTCAATTTCATGATTGTTTCGTTCGG
GGATGTGATGCATCTATTCTATTAGAT
ACGGTTGGAACAAATCAATCGGAGAAGGAAGCAAGGCCCAACCTATCACTATTAGGGTTTAACGAAATTGACCAAATCAAGTCCGAGGTTGAGAAAGCTTGTAGTGGAGTTGTTTCTTGT
GCTGATATTCTTGCTCTAGCTGCCCGTGATGCAGTTTCCTTTCCC
TTCAAAAATCGACCACGCTGGCCAGTCTTAACGGGAAGAAGAGATGGAACGATTTCACGATCATCAGAAGTTAGC
GGCAATATCCCATCGCCGTTCTCCGACTTTGCCACTCTTAAGCAAATTTTCGAGAATAAAAGGCTAAATGTTATTGATCTAGTTATTTTATCAG
GTGGTCACACACTTGGAGAAGCTCAT
TGTGGCACTTTCTCAAGGAGGTTATACAACTTCACAGGCAAAGGAGACGCAGATCCTTCATTAGATCCAAGATATGCAGATTTTCTTAGAACAAAGTGTCCAAATCCAGCTGATCCTTCC
ATTACAGTTGAAATGGATCCAAGAAGTTCTCGTTCTTTCGACTCCAACTATTTCAAAATTCTCACACAACATAAGGGTTTGTTTCAATCCGACGCTGCGCTTCTCAATGACACTTCCTCC
TCCCGGCTCGTCAGGTCGTTGCAGAATCCAAAGGTTTTCTCTTTTAGCTTTGCTAGTTCCATGTTGAAGATGGCAGCCATTGAAGTCCTCACTGGAAATAATAATGGTGAAATTAGGAAA
CAATGTCGTTTTGTTAATTAA

Retrieve as FASTA