Entry information : CsPrx17 (orange1.1g035578m/Cs2g15180)
Entry ID 8862
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx17 (orange1.1g035578m/Cs2g15180)
Name (synonym) CsPrx17 (orange1.1g035578m/Cs2g15180)
Class Class III peroxidase    [Orthogroup: Prx022]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx17
start..stop
S start..stop
CclPrx98 769 0 2..377 1..391
PpePrx04 474 1.07e-168 41..373 1..349
PpePrx50 472 4.14e-168 43..373 11..344
EcamPrx91 457 1.88e-161 5..375 8..397
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8862' 'complement(join(473584..474089,474201..474366,475964..476161,476873..477024,477070..477181))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 477070..477181 110 N° 2 476873..477024 150 N° 3 475964..476161 196 N° 4 474201..474366 164
N° 5 473584..474089 504  
complement(join(473584..474089,474201..474366,475964..476161,476873..477024,4770 70..477181))


exon

Literature and cross-references CsPrx17 (orange1.1g035578m/Cs2g15180)
DNA ref. Citrus sinensis Annotation Project:   chr2 (11983109..11991415) Phytozome 12:   scaffold00041 (477181..473584)
Protein sequence: CsPrx17 (orange1.1g035578m/Cs2g15180)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   377 (356)
PWM (Da):   %s   41903.68 (39376.3)  
PI (pH):   %s   6.24 (5.84) Peptide Signal:   %s   cut: 22 range:22-377
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMGRWVYVVLVISLILSLRNPKRFDTQTITDDELTHPSHELRLEYDYYRDKCPDAEKTVRSKMAQLYSQDKQVPANLLRLFFHDCFIMGCDASVFLDDSNGNESHPIERQAIPSQTLKGF
DKINLIKEELEEACPGMVSCADALALATRDGILLAGGPYYPVFTGRRDSIRSYFQEATAEIPGPDDDLNKILHLFSLRGFSPRETVSLIGAHNIGKISCQFIRNRLYDFLGTGQPDPTMS
DDFLVEMRVLCGDGNQTSLHGSPAPASAPAPMRSSGMRESTLGMNYYQRLSTSISSGAGFDAHYYQNLLRGRGLLHADQQLMAEEKTAKLVWAYASDCGTAYRTDFARVMLKMSNLGVLS
GSQGQVRTNCSLSLNSS*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGGGTAGGTGGGTTTATGTTGTTCTTGTAATCTCTTTGATTCTGTCATTGAGAAACCCAAAGAGATTCGATACACAAACAATAACAGATGATGAGTTAACTCATCCAAGTTTATCC
ATTTTCCTTCAAAGATCCCATTTCAATATAAGTCAAGGTGTCATGAACTTCGTCTTGAGTATGATTACTATAGAGACAAATGTCCTGATGCTGAAAAGACAGTGAGGTCAAAAATGGCCC
AACTTTACTCACAGGATAAACAAGTTCCCGCAAATTTGTTGCGCCTATTCTTCCACGACTGCTTCATCATG
GTATATCATTTTAATCTTTTGGTCACAATTCTTGGGTTTCTGTAGCTTT
CTCTCCAATGGCTTCTGTTCTCTTGCACTAAGTTGCTTTGCTGCTTCTTTTTCCGTATTCTTGTAAGGATTTTCTTCTCTTTGATCCTTTCTAATGATCTTCCTTTTCTAATTTTTTGCC
TTTAGTAGTTCTTTATGAGTATTAATTTCATCCCACTTGATCTTTTCTGGGTTTGTTCGTTTCCATGACTGCTCCATCGCGTATTCTTATCTTTTTCGATTCTTGGATTGATGTCAATTT
ATTTCCAATGGGTTCTGTTCTATTGCTCATATTTTTGCTTTTCTCCCTCTTTTTTTTTTCTTCTTGTTGGCTTTTGTTCTGGGTTCTTGAAAGGGTTCTGTTCCCTTTGGTCTGCTGTAA
TGTGCTTCTTTTTCCTTTTTCAATTTCTATAAATGAGCATTAAGTTTTCGATTCGAAATATTTTCCTAATTTCAGGTGGGTTTGTTCTTTTCTTATTGCTGAAATGGTTGATTACCATAA
TATTCTTTATAGTTTTTATTTGGTTGGGTTTCATCTTTTCTCAATTTCATGATGTTAGGCCTGAACAGACGTATTCATTGGTAAATTTTGCCTTCCATTTTGATTTTTTTAGTCCTGAAC
TTTTGTTAGCTCATGATTTTGCTGTTAATTGTTTGTGTCGTTCTGGTGTTTCTTTGAACCAGGGGGCTGTGATGCTTCGGTGTTCTTAGATGATAGCAACGGCAATGAGAGCCATCCAAT
AGAGAGGCAGGCGATTCCCAGCCAAACTCTCAAGGGCTTTGACAAAATTAATCTGATCAAGGAAGAGCTTGAAGAGGCTTGTCCAGGGATGGTTTCGTGTGCCGACGCACTAGCACTTGC
CACCAGAGATGGCATCCTTTTG
GTAAGATTTAATTCTCAGCTATTACTTTGTGTCTGTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCTTTTTTCCTCCTCTAATTNNNNNNNNN
NNNNNNNNNNNNNNNNAAGAAGAATACAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGGGGAAGAAGAATACAACCTGAAGATGCCTAAAAACATGTTGTTTGAATACTCCGTGGTTATGAACCCCGAACA
GTGAAAGAGATTTTATAGCTTGCTTTTGGGTAGAATTTTTCTGTATACTTGGAAAGTTCTGGCAGTGACCTTTCCATTTCCTTGTGGAAGGATAATTAGTAATTCCAGAAGATGAATGCT
CTCACGACATACTTTATATGTCTCTTTTATGTCTTTGCTAAGGGTTTGGGACAACTCTGAAAACTGAAATCAGTAACTTAAATATTATTAAGGTATCTCAACTTTGGTATGGTCTTATTA
GACAATTTAGAAAATTTTTAAGAATTCAATTATTGGTATCTGGTTCAACTAGGCACTAGCTGCTGTGATTGTTATGCTGCAGCTGCTGCCTTTAAATTGGCTGTTTTCTATAATTGAAAT
GAAAAAACATTTGGTTCAACTTACACTTGTCGAATCCAAAAGGGGAAAACCTTTAAACTATTTTGAAGTACCGATTCTTCTTTATGTTGAACGATATTAATGGATTCTGTTGGACTAAAT
ACCGTAGAAAATTTAAGCATATGCTAGACTTGATGTGGATCTGATGGGGCAATATCAGGACTCATAGGTTGATATGGCTATCAAGTGCTATAGGATCAGCATAACTTTTCCAGTGTGACT
CTTACTTATTGCTGAACTTTTAACAGAAGTAGGCTTCAAAACTGAAAAATATCATTATTACATAATATATGAAAACTCTTTGGAGATATCTATTGTGTTATTTTTCTTCAACTTCACTGG
GTACTATCCTTTTAATTACTTGCAAATCACTTGATGTCCTATGATTCTGTTATTTGCAGGTTTCTTTCTTAAAATTCTTGTAATTTATTCTTCTCTCTCTCAATCTGTCTCACCCTTTTT
CTTCAGCTGATTACAGCTCATATGATTCCATCGGCATGGTTTCTGACCTTAGAATCAAATTCATCTCTGCCAAATGATTGAATAGTCGGTTAATTCTTTTGTTTTGAAAAATTTGAAGAA
AGACTATATACATTTTCTTTCTTTTTACCTGTTAGTAAGGTTTCCCTCAGTTTTTCTTGGTTATGTTGTGCTTTTTAAGTTTCATATTTCTCTTGATACCCTTTTATGCTATTGGGTTAG
CATATGCTTATTTTTCATTGTTATTTAAGCACTCCAATGTTTGTGCAATGAAAGAACAGGCGCTGGTGGCCCATACTATCCAGTATTTACGGGCAGAAGAGACAGCATTAGATCGTACTT
TCAGGAAGCTACTGCTGAGATACCAGGACCTGATGATGATCTTAACAAGATTCTTCACCTGTTCTCGCTCAGAGGTTTCAGTCCAAGAGAAACAGTCAGTCTAATAG
GTACTCTTTCTAT
GCTTCTTCCTCCAGCTCTTGTGTATCATAGAGTAAATTAATGCTAAAACATTCGAATTAGAATCATAATCTGAATTTGATATTTTTTGTTATCTGAAGGGGGGCTCATAACATTGGAAAA
ATCAGTTGTCAATTCATTAGAAACCGCCTCTATGACTTTTTGGGGACAGGTCAGCCAGATCCTACCATGTCTGATGATTTTTTAGTTGAAATGAGGGTTCTTTGTGGGGATGGCAACCAA
ACTAGTCTTCATGGCTCTCCTGCTCCTGCTTCTGCGCCTGCTCCAATGAGATCTAGTGGAATGCGTGAGTCAACTCTAGGAATGAATTACTATCAGAGATTATCAACTTCCATCTCATCT
GGGGCAGGTTTTGACGCACATTACTATCAGAATTTGCTGAGAGGGAGAGGACTTCTCCATGCTGATCAGCAATTGATGGCTGAGGAGAAGACTGCAAAGCTGGTCTGGGCATATGCATCA
GACTGTGGAACAGCCTACAGAACAGACTTTGCCAGGGTTATGTTGAAGATGTCAAACCTTGGTGTCTTGTCCGGATCCCAAGGTCAGGTCCGAACAAACTGCTCCTTGTCACTTAACAGC
TCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGGGTAGGTGGGTTTATGTTGTTCTTGTAATCTCTTTGATTCTGTCATTGAGAAACCCAAAGAGATTCGATACACAAACAATAACAGATGATGAGTTAACTCATCCAAGTCATGAA
CTTCGTCTTGAGTATGATTACTATAGAGACAAATGTCCTGATGCTGAAAAGACAGTGAGGTCAAAAATGGCCCAACTTTACTCACAGGATAAACAAGTTCCCGCAAATTTGTTGCGCCTA
TTCTTCCACGACTGCTTCATCATG
GGCTGTGATGCTTCGGTGTTCTTAGATGATAGCAACGGCAATGAGAGCCATCCAATAGAGAGGCAGGCGATTCCCAGCCAAACTCTCAAGGGCTTT
GACAAAATTAATCTGATCAAGGAAGAGCTTGAAGAGGCTTGTCCAGGGATGGTTTCGTGTGCCGACGCACTAGCACTTGCCACCAGAGATGGCATCCTTTTG
GCTGGTGGCCCATACTAT
CCAGTATTTACGGGCAGAAGAGACAGCATTAGATCGTACTTTCAGGAAGCTACTGCTGAGATACCAGGACCTGATGATGATCTTAACAAGATTCTTCACCTGTTCTCGCTCAGAGGTTTC
AGTCCAAGAGAAACAGTCAGTCTAATAG
GGGCTCATAACATTGGAAAAATCAGTTGTCAATTCATTAGAAACCGCCTCTATGACTTTTTGGGGACAGGTCAGCCAGATCCTACCATGTCT
GATGATTTTTTAGTTGAAATGAGGGTTCTTTGTGGGGATGGCAACCAAACTAGTCTTCATGGCTCTCCTGCTCCTGCTTCTGCGCCTGCTCCAATGAGATCTAGTGGAATGCGTGAGTCA
ACTCTAGGAATGAATTACTATCAGAGATTATCAACTTCCATCTCATCTGGGGCAGGTTTTGACGCACATTACTATCAGAATTTGCTGAGAGGGAGAGGACTTCTCCATGCTGATCAGCAA
TTGATGGCTGAGGAGAAGACTGCAAAGCTGGTCTGGGCATATGCATCAGACTGTGGAACAGCCTACAGAACAGACTTTGCCAGGGTTATGTTGAAGATGTCAAACCTTGGTGTCTTGTCC
GGATCCCAAGGTCAGGTCCGAACAAACTGCTCCTTGTCACTTAACAGCTCTTAA

Retrieve as FASTA