Entry information : CsPrx03 (orange1.1g036121m/Cs1g15180)
Entry ID 8864
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx03 (orange1.1g036121m/Cs1g15180)
Name (synonym) CsPrx03 (orange1.1g036121m/Cs1g15180)
Class Class III peroxidase     [Orthogroup: Prx006]*
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx03
start..stop
S start..stop
CclPrx58 444 1e-159 1..241 10..249
PtaPrx97 230 2e-75 14..239 27..251
GbPrx53 230 3e-75 15..241 33..257
PabPrx206 229 7e-75 13..239 34..259
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 187236..187427 192 N° 2 186957..187145 189 N° 3 186727..186858 132 N° 4 186495..186539 45
N° 5 186267..186431 165  
complement(join(186267..186431,186495..186539,186727..186858,186957..187145,1872 36..187427))


exon

Literature and cross-references CsPrx03 (orange1.1g036121m/Cs1g15180)
DNA ref. Citrus sinensis Annotation Project:   chr1 (18408969..18412032) Phytozome 12:   scaffold00096 (187427..186267)
Protein sequence: CsPrx03 (orange1.1g036121m/Cs1g15180)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   241 (224)
PWM (Da):   %s   26524.14 (24802.3) Transmb domain:   %s   i2-24o
PI (pH):   %s   6.23 (6.24) Peptide Signal:   %s   cut: 18 range:18-241
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVLILWGSCCLFAGGNGVLVLHFYKKSCPSAEMPVKEEMKRKMLSDISSAAAILRLDFHDCQVDGCDGSILLGNSNGITTETLSDKNFGIRKVDIINEIKSSLETICPETVSCADFIQLAARDAVYLSGGPYIEVLTGRRDAVSGKKERADNQLPTYDISVSEFTGFSFRRDNKHAVWSQIGRWHGHTLGVSHCRNFQNRLWPIKDDTLSLAFSGMLEMICSNPTLSDISFAQNDATTLYL

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (3' end is missing due to 'NNNNN' in DNA).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGTTGATTTTGTGGGGTTCTTGCTGCTTGTTTGCAGGTGGAAATGGGGTACTTGTGCTTCACTTTTATAAAAAGAGTTGCCCTAGTGCAGAAATGCCAGTAAAAGAGGAGATGAAA
AGAAAAATGCTGAGTGATATTTCTTCTGCTGCTGCCATTCTTAGACTGGATTTTCATGATTGTCAAGTCGAT
GTAAATTTTTTTTTTCTTGTCTCACAAGTAATATATTTATATGATCTT
TGGTTTCCAAGCTTTGCTTATGTTTGTTACATTTTACTACAGGGTTGTGATGGATCAATTCTTCTCGGAAACTCAAACGGGATTACAACAGAAACATTATCGGACAAGAATTTCGGAATC
CGGAAGGTTGATATTATCAATGAGATAAAGAGTTCCCTTGAAACAATTTGTCCTGAAACAGTTTCTTGTGCTGATTTTATCCAGTTAGCTGCAAGGGATGCTGTATACCTG
GTGAGCTAC
ATCAGTTTCTTGAAAGACAAGGAAACTTTGAAAAAAATTCTATGAACTTATATTTGTACTCAAGAAACTTTTTTGTTTCCACTTTCCAGTCTGGAGGGCCATACATAGAGGTTTTAACTG
GAAGAAGAGATGCCGTTTCGGGAAAGAAGGAGAGAGCCGATAATCAGCTTCCGACTTACGATATTTCTGTCAGCGAATTCACTGGGTTTTCCTTCAGAAGA
ACATTAGTTTGGAAGATGG
AGTTGCACTCATGGGTACACAACTTGTACTAAAAATAAAATTCACCTTTCTTCCAAATGCTAATAATGTGTGCATTTTAAAAAAAATTTATTTCCCCTTTTCGCAATACGTTGTACATTG
GATTGTTGGTCCAGATTTTAAAAGATGCAGAGGTTTATGAGAGAGACTGACAATAAACATGCAGTATGGAGCCAAATTGGAAGATGGCATGGCCATCGGATATGTTATGTTAATATGTTA
CATTTTTCTAACTCTTGTTATGTGTTTCCAGGATCTCACACTCTAGGCGTAAGCCATTGCCGGAACTTCCAAAACAGGCTGTGGCCGATAAAGGATGATACATTGTCACTAGCATTTTCA
GGAATGCTGGAGATGATTTGCAGCAATCCTACGTTATCTGATATATCATTTGCCCAAAATGATGCTACTACTTTATATTTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGTTGATTTTGTGGGGTTCTTGCTGCTTGTTTGCAGGTGGAAATGGGGTACTTGTGCTTCACTTTTATAAAAAGAGTTGCCCTAGTGCAGAAATGCCAGTAAAAGAGGAGATGAAA
AGAAAAATGCTGAGTGATATTTCTTCTGCTGCTGCCATTCTTAGACTGGATTTTCATGATTGTCAAGTCGAT
GGTTGTGATGGATCAATTCTTCTCGGAAACTCAAACGGGATTACAACA
GAAACATTATCGGACAAGAATTTCGGAATCCGGAAGGTTGATATTATCAATGAGATAAAGAGTTCCCTTGAAACAATTTGTCCTGAAACAGTTTCTTGTGCTGATTTTATCCAGTTAGCT
GCAAGGGATGCTGTATACCTG
TCTGGAGGGCCATACATAGAGGTTTTAACTGGAAGAAGAGATGCCGTTTCGGGAAAGAAGGAGAGAGCCGATAATCAGCTTCCGACTTACGATATTTCT
GTCAGCGAATTCACTGGGTTTTCCTTCAGAAGA
GACAATAAACATGCAGTATGGAGCCAAATTGGAAGATGGCATGGCCACACTCTAGGCGTAAGCCATTGCCGGAACTTCCAAAACAGG
CTGTGGCCGATAAAGGATGATACATTGTCACTAGCATTTTCAGGAATGCTGGAGATGATTTGCAGCAATCCTACGTTATCTGATATATCATTTGCCCAAAATGATGCTACTACTTTATAT
TTG

Retrieve as FASTA