Entry information : CsPrx42 (orange1.1g039410m/Cs7g13530)
Entry ID 8868
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2016-01-14 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx42 (orange1.1g039410m/Cs7g13530)
Name (synonym) CsPrx42 (orange1.1g039410m/Cs7g13530)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx42
start..stop
S start..stop
CclPrx34 679 0 1..330 1..330
PtPrx31 526 0 8..329 4..330
NnPrx46 498 2e-179 27..330 37..339
VvPrx09 473 2e-169 27..329 34..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9416752..9416967 216 N° 2 9417085..9417279 195 N° 3 9417897..9418478 582  
join(9416752..9416967,9417085..9417279,9417897..9418478)


exon

Literature and cross-references CsPrx42 (orange1.1g039410m/Cs7g13530)
DNA ref. Citrus sinensis Annotation Project:   chr7 (9416944..9418925) GenBank:   NC_023052.1 (9416752..9418478) Phytozome 12:   scaffold00019 (81877..80151)
Cluster/Prediction ref. Genebank:   102621985
Protein sequence: CsPrx42 (orange1.1g039410m/Cs7g13530)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (305)
PWM (Da):   %s   36412.87 (33713.4) Transmb domain:   %s   i2-21o
PI (pH):   %s   9.63 (9.74) Peptide Signal:   %s   cut: 26 range:26-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFITSLISLLASLSFFLVFIPCNARLKHDFYKKTCPNVEKIIYNVASQKLLEAPVTAAGALRIFFHDCFVEGCDASVLIASSKTNKAERDSEINLSLPGDGYEVFFRAKRALELQCPGIVSCADIMAIATRDLVHLAGGPRWEVPKGRRDGLISKASRVEGNLPHVNQTISQTISLFKSKGLSTLDMVALSGGHTIGFSHCKEFMPRIYSYNKTHDIDPTMNQDFARSLRGSCPKSKKLDPTVVALNDVSTPFVFDNFYYKNIKKGLGLLATDQMLLLDSRTRAYVKRMADAKTAFFKHFVVAMIKLSNIGVKTGKDGEIRRDCGSFNG*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, introns 1 and 2). Incorrect prediction from Phytozome (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTATAACTTCATTAATCTCTCTCCTTGCTTCTCTCAGCTTCTTCTTAGTTTTTATTCCTTGCAATGCAAGACTTAAACATGATTTCTACAAAAAGACTTGCCCAAATGTGGAG
AAAATCATCTACAATGTGGCCTCGCAGAAGCTGCTTGAAGCACCAGTCACCGCCGCCGGGGCTCTTCGCATTTTCTTCCACGACTGCTTCGTTGAG
GTTTGATACACACACACACACACA
CACAACTAGAATGCCCCATTACCTTCTTAGCCATTACTTTAATTAATTAAAGATGGGGAATTTTGTAATATGAATTGATATTGTAATTTGAAGGGTTGTGATGCATCGGTCTTGATTGCG
TCAAGTAAAACCAACAAGGCCGAAAGGGATTCAGAAATCAACTTGTCACTTCCCGGCGATGGTTATGAAGTGTTCTTTCGAGCAAAGAGAGCGTTGGAGTTGCAGTGCCCTGGCATTGTC
TCTTGTGCCGATATTATGGCAATTGCTACAAGAGACTTGGTTCATTTG
GTAACTTCCTCTCATTCTCATCATTCACTTTCATTTTCACCGTTATTATTGCTCCCCCTTTCTGACTGTTAC
AACACTTTTTTAAAGTAGTGTCGCATAATGAAAGCTAATAACTGAGTGAGCATAAAAAACAAAGGGAGAATATTATTTTGGTCTCTTTTATAAATTATATTTACTACTTAGTTATTGGAT
AAATTTTTAATCTCCTATTTCATCTCTGGTGCTTACTGGTTTTGATTTGGAAAGTTTTAGCTAATCATTTTTTACATTATCACATTTACTATATGAATATTATTCTAAGAACAATAATAG
ATACAGCTTGAATGAGATTCCTTTAGGGGAAATGGATTCAACCCAATCAACCCACATGATGTGGAGAGATATTTAGTCTTTATTAAAAAAATTAAGGGCGGACTTAAGTGGTTAAAATAA
TTTCCAAAGGAGATTAAGGTGTTATTTTCTTAATAAATAAATATGTCGTAATAATTATCTAACAATTGACAGAGTGTATACATTAGCAGCGCTCAAATGCTTTCCCCTAAAAATTTTATG
AAGTAAATCATTAGCGTGTCCATTTATTTTTTACCAAGAAAAATTAACATGACTTGCTTCAAAAGGCGGGAGGCCCAAGATGGGAAGTACCAAAAGGAAGAAGAGATGGCCTTATTTCCA
AGGCTTCAAGAGTAGAGGGCAACCTCCCACATGTGAACCAAACAATATCTCAAACAATCTCACTCTTCAAATCGAAAGGCTTATCAACTCTGGACATGGTAGCCCTATCTGGAGGCCACA
CAATTGGCTTCTCGCATTGCAAAGAGTTCATGCCAAGAATCTATAGCTACAACAAAACACATGACATTGATCCAACCATGAACCAAGACTTTGCTCGCAGCCTTCGGGGTTCATGTCCTA
AGTCTAAGAAACTTGATCCAACTGTTGTTGCACTCAATGATGTCAGTACACCTTTCGTGTTTGATAATTTTTACTACAAAAATATTAAGAAGGGACTTGGGTTGCTGGCTACTGATCAGA
TGTTGCTTTTGGATTCAAGGACTCGAGCGTATGTGAAAAGAATGGCTGATGCTAAAACTGCATTTTTTAAGCACTTTGTTGTTGCCATGATCAAGTTGAGTAACATTGGGGTTAAGACTG
GCAAGGATGGTGAGATCAGGAGAGATTGTGGTTCCTTCAACGGTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTATAACTTCATTAATCTCTCTCCTTGCTTCTCTCAGCTTCTTCTTAGTTTTTATTCCTTGCAATGCAAGACTTAAACATGATTTCTACAAAAAGACTTGCCCAAATGTGGAG
AAAATCATCTACAATGTGGCCTCGCAGAAGCTGCTTGAAGCACCAGTCACCGCCGCCGGGGCTCTTCGCATTTTCTTCCACGACTGCTTCGTTGAG
GGTTGTGATGCATCGGTCTTGATT
GCGTCAAGTAAAACCAACAAGGCCGAAAGGGATTCAGAAATCAACTTGTCACTTCCCGGCGATGGTTATGAAGTGTTCTTTCGAGCAAAGAGAGCGTTGGAGTTGCAGTGCCCTGGCATT
GTCTCTTGTGCCGATATTATGGCAATTGCTACAAGAGACTTGGTTCATTTG
GCGGGAGGCCCAAGATGGGAAGTACCAAAAGGAAGAAGAGATGGCCTTATTTCCAAGGCTTCAAGAGTA
GAGGGCAACCTCCCACATGTGAACCAAACAATATCTCAAACAATCTCACTCTTCAAATCGAAAGGCTTATCAACTCTGGACATGGTAGCCCTATCTGGAGGCCACACAATTGGCTTCTCG
CATTGCAAAGAGTTCATGCCAAGAATCTATAGCTACAACAAAACACATGACATTGATCCAACCATGAACCAAGACTTTGCTCGCAGCCTTCGGGGTTCATGTCCTAAGTCTAAGAAACTT
GATCCAACTGTTGTTGCACTCAATGATGTCAGTACACCTTTCGTGTTTGATAATTTTTACTACAAAAATATTAAGAAGGGACTTGGGTTGCTGGCTACTGATCAGATGTTGCTTTTGGAT
TCAAGGACTCGAGCGTATGTGAAAAGAATGGCTGATGCTAAAACTGCATTTTTTAAGCACTTTGTTGTTGCCATGATCAAGTTGAGTAACATTGGGGTTAAGACTGGCAAGGATGGTGAG
ATCAGGAGAGATTGTGGTTCCTTCAACGGTTAA

Retrieve as FASTA