Entry information : CsPrx58 (orange1.1g039981m/orange1.1t02059)
Entry ID 8872
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2016-01-14 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx58 (orange1.1g039981m/orange1.1t02059)
Name (synonym) CsPrx58 (orange1.1g039981m/orange1.1t02059)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx58
start..stop
S start..stop
CclPrx107 651 0 1..328 1..328
PpePrx78 479 3e-172 2..326 4..324
PpePrx73 479 6e-172 2..326 4..324
PkPrx01 439 2e-156 6..326 5..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 452396..452602 207 N° 2 452883..453077 195 N° 3 453990..454155 166 N° 4 454342..454760 419
join(452396..452602,452883..453077,453990..454155,454342..454760)


exon

Literature and cross-references CsPrx58 (orange1.1g039981m/orange1.1t02059)
DNA ref. Citrus sinensis Annotation Project:   chrUn (32353877..32356241) GenBank:   NW_006257092.1 (452396..454760) Phytozome 12:   scaffold00043 (159635..162004)
Cluster/Prediction ref. Genebank:   102607919 [Incorrect prediction]
Protein sequence: CsPrx58 (orange1.1g039981m/orange1.1t02059)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (306)
PWM (Da):   %s   35305.52 (32673.2)  
PI (pH):   %s   5.35 (5.09) Peptide Signal:   %s   cut: 23 range:23-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSWFRITTIFLFLALMFGASNAQLSSTFYATTCPNVSSIVRGVVEQARNNDARIGARLIRVHFHDCFVNGCDGSLLLDDSAPGGIQSEKNGNPNLSTGGYEVVDDIKTALENVCPGVVSCADILAIASQILVSLDGGPTWQVQLGRRDSRTANLAGTSGIPLGNETLDRISEKFRAVGLDDPTDLVALSGAHTFGRARCVAFRNRLFNFDGAGNPDPTIDPTYLQTLRQNCPQGGNGNALVDLDPTTADGFDNNYFTNLQNNRGLLTSDQVLFSTTGAKTVAIVNRFANSQTDFFDTFGQAMIKMGNIRPLTGNNGEIRSNCRRINSN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Incorrect prediction from Phytozome (short PS is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTGGTTTCGAATTACAACTATTTTTCTCTTTCTTGCTTTAATGTTTGGAGCATCTAATGCCCAATTGAGCTCAACATTTTATGCTACCACATGCCCTAATGTGTCAAGCATTGTA
CGCGGTGTTGTAGAGCAAGCTCGAAACAATGATGCCCGAATTGGCGCCAGACTCATTCGTGTCCACTTCCATGATTGCTTTGTTAAT
GTAATTGCTTTGCCCCTTGTGGCTTGCCGAACT
TTTATTTTTTTATTATTGTTTTTATTCTTAATTTTTTTTAAAAAAAGATAAAGTGTGTGTCCAAATTAATTTTTTAATTACTATCTTTCCTAGAGTTTGAACTCATGTGAATGATCAGCC
AAATAAAACTATTGAAAACCATTCGACAAAGCCCCTTCATTAAAAAGCTAACTCATGTCATATTATTATTTAGTAAATACTAATGAATAGATATATATTTTTAATCTATTTTTCTCTCTA
TATATAGGGCTGTGATGGGTCACTTTTGCTTGATGATTCAGCCCCCGGTGGCATACAGAGCGAGAAAAATGGAAACCCCAACCTATCAACCGGCGGGTATGAAGTAGTTGATGACATCAA
AACTGCACTAGAGAACGTTTGCCCCGGTGTCGTCTCCTGTGCTGATATCTTGGCCATTGCATCTCAAATCTTGGTTTCTTTG
GTAATTTCATTACCTAGTTTCCTATATATGTTTCTTCT
ACTATCTTAATTAGTAAGAGTCGTTCTCTAGTACAGACATTTGCAAGCAGAATTACACATGATACTTATTTCTATAATTTAGCACACACTATAGTTATTTATTTATTCTTAGCTTTTGCA
TCGTGGAAACTAGATATTTCCGTCCGACTTTAATGAGCGTGTATAAGAGATTTTATTTATTGAAACAATAAGCACTTACAATATAATTCTGTCTTTCTATCTGAATCTGTTAATTTGCCT
AATCATTTATGTAATTGGTTAGATAGCTGCCGGCATGTGAGTCAGCAATCAGTCATGCAACTTTCATATTGTTCAGCGCTATTTTAACTCTCATATTTAGTGTGAGCAGATGCTACTAAA
CACAGTTGTATAAACACTTGCAATCACAGTTCATCAGTTAATGACTCTAAGACATATTTTTCTCAAATTTGCTCTCTCTAGATCCTTCACTCTCTCTCTCTCTCTCTCTCTCTCTCTGCT
TTCTTGTTAACCAAGAAAAGTGTTTGATAAAACTTAACTAAAATTTCTCCTACAAAACAATTACCAAAATAATAATAATAATAAAGGATAATAATATTCTTCATTTTTATTCTACACCAA
TCAATTAACATTACGTGATCTTTTAAGACGTCTTCTGCTGTACGGCCAAGGCGGATGTACGGTACAGCAGTCATTGAAAATATTCATACTTAGTAGTAAATTAACTTTTTAAACAATCAT
AATTAACACTGAATGTTTGAAAAATTGTTTTGAGTTTGGCTTAGAAGTCTAATTGAGGTGATAGATAAAAGTTTAACAATAATATTTAAAGTGAGACTCACAAGTTTTTTCCAGTGAAAC
ATGAGACTAAAATTAAGAAATGGGAATTTTGCAGGACGGAGGTCCAACGTGGCAAGTGCAGCTAGGAAGGAGAGATAGCAGGACTGCAAATCTAGCTGGGACTTCAGGCATTCCACTCGG
CAATGAAACCCTCGATCGAATTTCTGAAAAGTTCAGAGCTGTAGGACTTGATGATCCGACTGACCTAGTTGCTTTATCAG
GTATATTTGCTATTTAACATTGCTAAACTGATCTTTTTAG
CCTTGAATTCAAACTCAGTAGCTAGCTAAAGAAAACTGTTTTAAAAATCACTCGGCTGTGCATGTACTGGAGGCTTATTTGTTATATCTTCTTCTCATGATATGTAGCATTTACATGGAA
CTAATATAAATTACCGTGTGTCCCAGGTGCACATACATTTGGACGTGCTCGGTGTGTAGCATTCAGGAACCGTCTGTTCAATTTCGACGGGGCCGGAAACCCTGATCCGACCATAGATCC
GACGTATCTTCAAACCCTCCGCCAAAATTGCCCGCAAGGCGGCAATGGCAATGCCTTAGTCGATCTTGATCCGACGACGGCTGATGGTTTTGACAATAACTATTTTACAAATCTTCAAAA
CAACCGAGGGCTTCTTACATCTGATCAAGTTTTGTTCTCTACAACTGGCGCTAAGACTGTTGCCATTGTCAACCGCTTCGCTAATAGCCAAACGGACTTTTTTGATACTTTTGGGCAAGC
AATGATCAAAATGGGAAATATAAGGCCATTGACTGGGAATAATGGTGAGATTAGGTCCAATTGCAGGAGGATCAATTCAAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTGGTTTCGAATTACAACTATTTTTCTCTTTCTTGCTTTAATGTTTGGAGCATCTAATGCCCAATTGAGCTCAACATTTTATGCTACCACATGCCCTAATGTGTCAAGCATTGTA
CGCGGTGTTGTAGAGCAAGCTCGAAACAATGATGCCCGAATTGGCGCCAGACTCATTCGTGTCCACTTCCATGATTGCTTTGTTAAT
GGCTGTGATGGGTCACTTTTGCTTGATGATTCA
GCCCCCGGTGGCATACAGAGCGAGAAAAATGGAAACCCCAACCTATCAACCGGCGGGTATGAAGTAGTTGATGACATCAAAACTGCACTAGAGAACGTTTGCCCCGGTGTCGTCTCCTGT
GCTGATATCTTGGCCATTGCATCTCAAATCTTGGTTTCTTTG
GACGGAGGTCCAACGTGGCAAGTGCAGCTAGGAAGGAGAGATAGCAGGACTGCAAATCTAGCTGGGACTTCAGGCATT
CCACTCGGCAATGAAACCCTCGATCGAATTTCTGAAAAGTTCAGAGCTGTAGGACTTGATGATCCGACTGACCTAGTTGCTTTATCAG
GTGCACATACATTTGGACGTGCTCGGTGTGTA
GCATTCAGGAACCGTCTGTTCAATTTCGACGGGGCCGGAAACCCTGATCCGACCATAGATCCGACGTATCTTCAAACCCTCCGCCAAAATTGCCCGCAAGGCGGCAATGGCAATGCCTTA
GTCGATCTTGATCCGACGACGGCTGATGGTTTTGACAATAACTATTTTACAAATCTTCAAAACAACCGAGGGCTTCTTACATCTGATCAAGTTTTGTTCTCTACAACTGGCGCTAAGACT
GTTGCCATTGTCAACCGCTTCGCTAATAGCCAAACGGACTTTTTTGATACTTTTGGGCAAGCAATGATCAAAATGGGAAATATAAGGCCATTGACTGGGAATAATGGTGAGATTAGGTCC
AATTGCAGGAGGATCAATTCAAATTAA

Retrieve as FASTA