Entry information : CsPrx26 (orange1.1g041231m/ peroxidase 9-like/Cs3g25300)
Entry ID 8876
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2016-01-14 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx26 (orange1.1g041231m/ peroxidase 9-like/Cs3g25300)
Name (synonym) CsPrx26 (orange1.1g041231m/ peroxidase 9-like/Cs3g25300)
Class Class III peroxidase    [Orthogroup: Prx036]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx26
start..stop
S start..stop
CclPrx21 702 0 1..345 1..345
BrPrx09-1Aa_other 563 0 1..345 1..347
ThasPrx40 561 0 1..345 1..346
AtPrx09 552 0 1..345 1..346
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26985736..26986002 267 N° 2 26985402..26985593 192 N° 3 26985138..26985303 166 N° 4 26983919..26984331 413
complement(join(26983919..26984331,26985138..26985303,26985402..26985593,2698573 6..26986002))


exon

Literature and cross-references CsPrx26 (orange1.1g041231m/ peroxidase 9-like/Cs3g25300)
DNA ref. Citrus sinensis Annotation Project:   chr3 (26982052..26984393) GenBank:   NC_023048.1 (26986002..26983919) Phytozome 12:   scaffold00002 (3260331..3258974)
Cluster/Prediction ref. Genebank:   102626970
Protein sequence: CsPrx26 (orange1.1g041231m/ peroxidase 9-like/Cs3g25300)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   346 (322)
PWM (Da):   %s   37429.13 (34810.6)  
PI (pH):   %s   7.31 (6.50) Peptide Signal:   %s   cut: 24 range:24-345
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFFKFAITLLLLALISARISLAHPGIGIGWGGNGQYGGSFYGLFPQFYQFSCPQVDNIVMSVLQEAIARQPRIAASLLRLHFHDCFVQGCDASVLLDDSAAIVSEKNSVPNRNSLRGFEVIDEIKAKLEEACPQTVSCADIVALAARGSVVLSGGPAWELPLGRRDSRTASLSGSNSNIPPPNSTVQNLISSFKRQGLNEVDLVSLSGGHTIGVARCVTFKQRLYNQNGNNQPDETLERTYYFGLKSVCPRTGGDNNISPLDFASPAKFDNTYFKLVLLGKGLLTSDEVLLTGDVGNIVQLVKSYAEDDELFFKQFAQSMVKMGNISPLTGFNGEVRKNCRLVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCTTCAAATTTGCTATCACTCTACTGCTACTAGCTTTGATCTCAGCCAGGATCTCACTAGCTCACCCTGGAATTGGCATTGGCTGGGGTGGTAATGGCCAGTATGGAGGCAGC
TTCTATGGCCTCTTTCCACAGTTTTATCAGTTTTCATGCCCACAAGTTGATAACATTGTCATGTCAGTGCTCCAGGAGGCCATTGCAAGACAGCCCAGAATAGCTGCCTCTTTGCTTAGG
CTTCATTTCCATGATTGCTTTGTTCAG
GTTTCTCACTTTTAGTATACCTAGTAGTACAAAACACTCGATTCTTTCCTTTTTTTCTTCTTTTTTTTTTTTTTTCAAAGTGTAGTTAACTTC
GTATGTATGCATAGGTGTTTATGACTTACAGTTTTATTACTAATTACAGGGCTGTGATGCTTCCGTCTTGTTGGACGATTCTGCAGCTATAGTTAGTGAAAAGAATTCAGTACCAAACAG
GAATTCCCTCAGAGGATTTGAAGTGATTGACGAGATCAAGGCTAAGCTGGAAGAAGCATGTCCTCAGACTGTTTCTTGTGCAGACATTGTCGCCCTAGCTGCTCGCGGCTCCGTTGTACT
A
GTAAGCAAAATTCTAACAAAACTGATGTTAGGTAGATCATATAAAAGATTCAGGACAGAGAACTTTGTTAATAACTATTACTGGGTATGCTCAAACAGAGCGGAGGACCGGCTTGGGAG
CTCCCCCTTGGAAGGAGGGACTCGAGAACAGCAAGCTTAAGTGGCTCAAACAGTAACATTCCCCCGCCAAACTCTACCGTCCAAAACCTTATATCATCCTTCAAGCGTCAAGGCCTAAAT
GAAGTAGACCTTGTCTCTCTTTCAG
GTAATTAATTACTGTATAGCACTGCATTTAATGAACTGAACCTGATTCTCTAAACTAAGGTAGCATTTACTTTTTAGATTGGATTGGGAATCTTG
GGGAGTGGGAATCCTAGGATTGGGAGTGTGGAGTGGGAGTGAGAGTAGGTTGTTTACTTACACTGAAATGGAAGCATGGAATGGAGATCAGAATCCAATTTATATGTTTACTTTGTCTTG
GATTGTGAGTAAATAGTTTCAAATTACAATTTTATCCTTATTTAAAGAATTATAATTTTTAATTACAAAACTAATAAAAAATATATTTAATGAATAATATTTATTTTATTATATTTGTAA
ATTTATTATAATTATTAATATTCTTAATTATGAACAATAAATTATTAATTGTAATTTTAATATAAAATGAAATGTTATTTTATTTTATTTAATATAATTATATTAAATTTATTATTTAAA
ATAATTTTAACTTAGAATCAATGTAAATTATTATTTAGTTAAATATAATATTATTATTTAAATAAATATAATATTATTATTTAAATAAATATAATATTATTATTTAAATAAATATAATAT
TATTTATTTTATTTTATTAAGTATAAAACATAAAATAAAAAAAAAGGGTAGAAATGGGAGAGGTGGGAGTGGAGGGAGTGGATTCCCACTCCCACTCCCCACTCCAAAAATGAGTGGGGC
CCACGGAGTGGAACTCCCAATCCCTCCTCATTTTGAGTAAGTAAACTGCTGCTCACTCCCACTCCAGCAAGTAAACACAACATAAGTATTTTGTTTGATGTCATGTTGCAGGAGGGCATA
CAATTGGGGTGGCAAGGTGTGTGACCTTCAAGCAAAGGCTATATAATCAAAATGGAAACAACCAACCGGATGAGACTTTAGAGAGGACATATTACTTCGGTTTAAAATCAGTCTGCCCAA
GAACAGGCGGCGACAATAACATCTCCCCGTTAGACTTTGCCTCACCAGCAAAATTTGATAACACCTACTTCAAGCTTGTTCTGTTGGGCAAAGGGCTTCTCACATCTGATGAAGTGCTTT
TGACAGGCGATGTGGGGAACATTGTGCAACTAGTTAAGTCCTACGCTGAGGATGATGAGCTCTTCTTTAAACAGTTTGCTCAGTCAATGGTTAAGATGGGGAACATTAGTCCTCTCACTG
GCTTTAATGGTGAAGTTAGGAAGAATTGTCGCCTAGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCTTCAAATTTGCTATCACTCTACTGCTACTAGCTTTGATCTCAGCCAGGATCTCACTAGCTCACCCTGGAATTGGCATTGGCTGGGGTGGTAATGGCCAGTATGGAGGCAGC
TTCTATGGCCTCTTTCCACAGTTTTATCAGTTTTCATGCCCACAAGTTGATAACATTGTCATGTCAGTGCTCCAGGAGGCCATTGCAAGACAGCCCAGAATAGCTGCCTCTTTGCTTAGG
CTTCATTTCCATGATTGCTTTGTTCAG
GGCTGTGATGCTTCCGTCTTGTTGGACGATTCTGCAGCTATAGTTAGTGAAAAGAATTCAGTACCAAACAGGAATTCCCTCAGAGGATTTGAA
GTGATTGACGAGATCAAGGCTAAGCTGGAAGAAGCATGTCCTCAGACTGTTTCTTGTGCAGACATTGTCGCCCTAGCTGCTCGCGGCTCCGTTGTACTA
AGCGGAGGACCGGCTTGGGAG
CTCCCCCTTGGAAGGAGGGACTCGAGAACAGCAAGCTTAAGTGGCTCAAACAGTAACATTCCCCCGCCAAACTCTACCGTCCAAAACCTTATATCATCCTTCAAGCGTCAAGGCCTAAAT
GAAGTAGACCTTGTCTCTCTTTCAG
GAGGGCATACAATTGGGGTGGCAAGGTGTGTGACCTTCAAGCAAAGGCTATATAATCAAAATGGAAACAACCAACCGGATGAGACTTTAGAGAGG
ACATATTACTTCGGTTTAAAATCAGTCTGCCCAAGAACAGGCGGCGACAATAACATCTCCCCGTTAGACTTTGCCTCACCAGCAAAATTTGATAACACCTACTTCAAGCTTGTTCTGTTG
GGCAAAGGGCTTCTCACATCTGATGAAGTGCTTTTGACAGGCGATGTGGGGAACATTGTGCAACTAGTTAAGTCCTACGCTGAGGATGATGAGCTCTTCTTTAAACAGTTTGCTCAGTCA
ATGGTTAAGATGGGGAACATTAGTCCTCTCACTGGCTTTAATGGTGAAGTTAGGAAGAATTGTCGCCTAGTTAATTAA

Retrieve as FASTA