Entry information : CsPrx63 (orange1.1g041705m/orange1.1t03556)
Entry ID 8879
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx63 (orange1.1g041705m/orange1.1t03556)
Name (synonym) CsPrx63 (orange1.1g041705m/orange1.1t03556)
Class Class III peroxidase     [Orthogroup: Prx017]*
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx63
start..stop
S start..stop
CclPrx86 374 1e-134 1..184 1..184
CclPrx116 366 8e-130 1..182 1..182
GmPrx172 284 2e-97 1..183 1..184
GmPrx03 283 4e-97 1..183 1..183
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 290..490 201 N° 2 622..804 183 N° 3 929..1135 207  
join(290..490,622..804,929..1135)


exon

Literature and cross-references CsPrx63 (orange1.1g041705m/orange1.1t03556)
DNA ref. Citrus sinensis Annotation Project:   chrUn (54352821..54355732) Phytozome 12:   scaffold02651 (290..1135)
Protein sequence: CsPrx63 (orange1.1g041705m/orange1.1t03556)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   197 (177)
PWM (Da):   %s   19984.04 (17723.8)  
PI (pH):   %s   4.58 (4.48) Peptide Signal:   %s   cut: 21 range:21-197
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALFYALLFALVFLIRYSAGQLKIGFYSETCPEAESIVSSVVQDAVVSDPNLAAVLLRLHFHDCFVEGCDGSILIENGPNAEKHAFGHQGVGGFEVIEKAKARSEDACPGVVSCADIVALAARDAIALSNGPSYQVPTGRRDGEVSNVTLADDMPDVSDSIQQLKTKFLHNGLSEKDLVLLSGMxxxxxxxxxMHLL

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (3' end is missing due to 'NNNNN' in DNA).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCTATTTTATGCATTGCTGTTTGCATTAGTATTTTTAATCCGCTACTCTGCTGGGCAGCTCAAAATCGGCTTTTATTCTGAAACATGCCCTGAAGCAGAGTCTATTGTCAGTAGT
GTAGTTCAAGATGCAGTTGTCTCAGACCCCAACTTGGCCGCAGTCTTGCTTAGGCTCCATTTCCATGATTGCTTCGTTGAG
GTCTTCTGTAACCATAATTATTTCTGCCTGTCTTTTTTC
TTTTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTAAACTGTTTGCTAGGGGTGCGATGGATCAATTCTAATAGAGA
ACGGTCCAAATGCTGAGAAGCATGCATTTGGTCACCAAGGTGTTGGAGGGTTTGAAGTAATAGAAAAAGCCAAGGCCCGCTCGGAAGATGCATGCCCAGGAGTTGTGTCTTGTGCAGATA
TTGTGGCCTTGGCAGCTCGAGATGCTATAGCTCTA
GTTTGTTTAACTCCTTAATAATTTATTTATTTATTAATAAACATCTAATTTCTTTACATTTAAGCTATCGTACGTACGCTATCGT
CAATTAAAGATTAATATAATTAATAATTGATGAATGCAGTCAAATGGACCGAGCTACCAGGTTCCAACCGGGCGCAGAGATGGTGAAGTTTCAAATGTTACGCTGGCAGATGATATGCCC
GATGTTAGTGATTCAATTCAGCAACTCAAGACTAAGTTTTTGCACAATGGGCTATCGGAGAAGGATCTAGTACTTCTTAGCGGTATGNNNNNNNNNNNNNNNNNNNNNNNNNNNATGCAT
CTCTTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCTATTTTATGCATTGCTGTTTGCATTAGTATTTTTAATCCGCTACTCTGCTGGGCAGCTCAAAATCGGCTTTTATTCTGAAACATGCCCTGAAGCAGAGTCTATTGTCAGTAGT
GTAGTTCAAGATGCAGTTGTCTCAGACCCCAACTTGGCCGCAGTCTTGCTTAGGCTCCATTTCCATGATTGCTTCGTTGAG
GGGTGCGATGGATCAATTCTAATAGAGAACGGTCCAAAT
GCTGAGAAGCATGCATTTGGTCACCAAGGTGTTGGAGGGTTTGAAGTAATAGAAAAAGCCAAGGCCCGCTCGGAAGATGCATGCCCAGGAGTTGTGTCTTGTGCAGATATTGTGGCCTTG
GCAGCTCGAGATGCTATAGCTCTA
TCAAATGGACCGAGCTACCAGGTTCCAACCGGGCGCAGAGATGGTGAAGTTTCAAATGTTACGCTGGCAGATGATATGCCCGATGTTAGTGATTCA
ATTCAGCAACTCAAGACTAAGTTTTTGCACAATGGGCTATCGGAGAAGGATCTAGTACTTCTTAGCGGTATGNNNNNNNNNNNNNNNNNNNNNNNNNNNATGCATCTCTTA

Retrieve as FASTA