Entry information : CsPrx01 (orange1.1g043399m/Cs1g12340, 50, 60)
Entry ID 8882
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2017-12-13 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-12-13 (Qiang Li)
Peroxidase information: CsPrx01 (orange1.1g043399m/Cs1g12340, 50, 60)
Name (synonyms) CsPrx01 (orange1.1g043399m/Cs1g12340, 50, 60)
Class Class III peroxidase     [Orthogroup: Prx026]*
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx01
start..stop
S start..stop
CclPrx10 572 0 1..287 1..287
CsPrx02 391 8e-136 9..316 16..320
CclPrx09 389 1e-133 9..280 16..286
PtPrx19 266 1e-87 74..285 15..229
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..360 360 N° 2 684..872 189 N° 3 973..1138 166 N° 4 1400..1545 146
N° 5 1637..1870 234  
join(1..360,684..872,973..1138,1400..1545,1637..1870)


exon

Literature and cross-references CsPrx01 (orange1.1g043399m/Cs1g12340, 50, 60)
DNA ref. Citrus sinensis Annotation Project:   chr1 (15375260..15377129) Phytozome 12:   scaffold00266 (81035..82419)
Protein sequence: CsPrx01 (orange1.1g043399m/Cs1g12340, 50, 60)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364
PWM (Da):   %s   40215.18  
PI (pH):   %s   4.97
Sequence 405
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRIVISFSISFENRNADTKKALNINSTSNFLHYVCYEYPASDPSLFRIAAGAGALFLSNGGKIEEGDCGEPYDSLQYDFNRDSCPQAEGRIRAMVWYLRKSRSGVAPAFLRLVFRDCSIEGCDSSVLLDEADGVDSEKMSLPSESLNRFYVINIIKEDLEEICPGVVSYSDTLPLAAREGVVLAGGPFYPLHTGRRDSRLALADIATFELPLPNADLPETLASFASRGFDLRETVTFLDAHGIGVIHCIFFKSHLCNLGRINESLDPGFLNLLRSKCRNVHSGSAVLAAPFNPLYIGSRDSMQMLTFAVIATNAGLSTFELREMSSLCRRMYLSFLSILCIIQSDYDSVVQLIIYSMYLTLQKL

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (Both 5' end and 3' end are missing due to 'NNNNN' in DNA). Bad annotation in CAP.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCGAATAGTGATCAGCTTCTCGATCTCTTTCGAGAACCGAAACGCCGATACCAAGAAAGCCTTGAACATCAACTCCACCAGTAATTTCTTGCATTATGTTTGTTACGAGTATCCAGCGT
CGGATCCTTCTCTCTTTCGGATAGCCGCCGGCGCTGGGGCCCTGTTCTTGTCCAATGGCGGGAAAATTGAAGAAGGCGACTGTGGCGAGCCTTATGATTCTTTGCAGTACGATTTCAACC
GCGATTCGTGCCCACAAGCTGAGGGCCGTATTCGGGCCATGGTTTGGTATCTCCGAAAATCACGCTCCGGTGTAGCTCCTGCTTTCTTGCGCCTCGTTTTCCGGGATTGCTCCATTGAG
G
TCCATTTTTATTCAGTCAACTTCAGTCAAATATTATTTTGTGTGTGTGTGTGTGTTTTTTTTTTTTTTTTTTATATATATTCTGATTTTTGTTAAATCTTGAATTTCTTTTTACTTCTTG
CTATTTCTAGTTATTTCATCCACTGATATACTCTCCAAACAATCTTGTTTATTCCGCTAATTTTTCACTAGGGTTATCTGATTTATTCACATTTTGATCTGGGTTAAGCAATTATTTTAT
GTGCAATTTTGTTAATTGGGTTCTTGCTATTTCAATCAGATTAATTTTGAGTTGAGTTTTCTGTAATTTGGAACTTGTTTAGGGTTGTGATTCTTCAGTTCTACTGGATGAAGCTGATGG
AGTAGACTCAGAGAAAATGTCTCTTCCCAGTGAATCTCTCAATCGTTTCTATGTAATCAATATAATCAAAGAGGATCTCGAAGAAATTTGCCCTGGTGTGGTTTCTTATTCGGATACTCT
TCCTTTGGCTGCCAGAGAAGGTGTTGTTCTG
GTAAATTCCTGTATCATGTGACCATCCAAATCTATGAAATCTGGCTTTCTATCTATGTTTGTACAATCTGTATAGATAATCATTGTGTC
TTTGAATTTAGGCTGGTGGTCCATTCTATCCACTGCATACTGGCAGGAGAGACAGCAGGCTTGCTCTTGCAGATATAGCAACATTTGAGCTTCCTTTACCCAATGCTGATCTGCCTGAAA
CCCTTGCATCTTTTGCATCAAGGGGGTTTGATTTAAGAGAAACTGTTACATTTTTGG
GTAGAGAGAAATCCTTATTTCATTTCATGTTCCTTTTTATTTTCATGGAAAAGAGAAATTTCT
GATTTTGGTTTGTATTTAATTGCTGCTGCAACTTTTTGCAATTTCCCCGTTCCAGCTGGTTGTCTGATAGTTTAGTTCTGATCTCTTTGGTTCAAAATTTGATACTTGAGCTTAGGAGAT
TTCTTAAGATTTCTAACCTTGTTATGGTTCAGTTTTGTGATAATAACAAGTACTGTTAGTCTGTGATTTTGTTCCCAGATGCTCATGGCATTGGAGTCATCCACTGCATATTCTTCAAGA
GTCATCTCTGTAACTTGGGGAGGATTAATGAATCTCTGGATCCCGGTTTTTTGAATCTGTTGAGATCAAAATGCAGAAACGTGCATTCAGGGAGTGCTGTTCTG
GTAAATTGCAGACTAC
GTACCCAAATTTTATAAATCAGGCTCACTCTTACCTGTGTAAAACCATTGTTTCTTTTGTCTCTTTGAATTTTAGGCTGCTCCATTCAATCCACTCTATATCGGAAGCAGAGACAGTATG
CAAATGCTTACTTTTGCTGTTATTGCAACGAATGCTGGTCTGTCCACATTCGAATTAAGAGAAATGTCTTCCCTCTGCAGGCGTATGTATTTATCTTTTCTTTCCATTTTATGCATTATT
CAATCAGATTATGATAGTGTAGTTCAACTAATCATTTATTCAATGTATTTAACCTTACAGAAGCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCGAATAGTGATCAGCTTCTCGATCTCTTTCGAGAACCGAAACGCCGATACCAAGAAAGCCTTGAACATCAACTCCACCAGTAATTTCTTGCATTATGTTTGTTACGAGTATCCAGCGT
CGGATCCTTCTCTCTTTCGGATAGCCGCCGGCGCTGGGGCCCTGTTCTTGTCCAATGGCGGGAAAATTGAAGAAGGCGACTGTGGCGAGCCTTATGATTCTTTGCAGTACGATTTCAACC
GCGATTCGTGCCCACAAGCTGAGGGCCGTATTCGGGCCATGGTTTGGTATCTCCGAAAATCACGCTCCGGTGTAGCTCCTGCTTTCTTGCGCCTCGTTTTCCGGGATTGCTCCATTGAG
G
GTTGTGATTCTTCAGTTCTACTGGATGAAGCTGATGGAGTAGACTCAGAGAAAATGTCTCTTCCCAGTGAATCTCTCAATCGTTTCTATGTAATCAATATAATCAAAGAGGATCTCGAAG
AAATTTGCCCTGGTGTGGTTTCTTATTCGGATACTCTTCCTTTGGCTGCCAGAGAAGGTGTTGTTCTG
GCTGGTGGTCCATTCTATCCACTGCATACTGGCAGGAGAGACAGCAGGCTTG
CTCTTGCAGATATAGCAACATTTGAGCTTCCTTTACCCAATGCTGATCTGCCTGAAACCCTTGCATCTTTTGCATCAAGGGGGTTTGATTTAAGAGAAACTGTTACATTTTTGG
ATGCTC
ATGGCATTGGAGTCATCCACTGCATATTCTTCAAGAGTCATCTCTGTAACTTGGGGAGGATTAATGAATCTCTGGATCCCGGTTTTTTGAATCTGTTGAGATCAAAATGCAGAAACGTGC
ATTCAGGGAGTGCTGTTCTG
GCTGCTCCATTCAATCCACTCTATATCGGAAGCAGAGACAGTATGCAAATGCTTACTTTTGCTGTTATTGCAACGAATGCTGGTCTGTCCACATTCGAAT
TAAGAGAAATGTCTTCCCTCTGCAGGCGTATGTATTTATCTTTTCTTTCCATTTTATGCATTATTCAATCAGATTATGATAGTGTAGTTCAACTAATCATTTATTCAATGTATTTAACCT
TACAGAAGCTCTGA

Retrieve as FASTA