Entry information : CsPrx16 (orange1.1g044134m/Cs2g11900/)
Entry ID 8884
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-05 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx16 (orange1.1g044134m/Cs2g11900/)
Name (synonym) CsPrx16 (orange1.1g044134m/Cs2g11900/)
Class Class III peroxidase    [Orthogroup: Prx038]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx16
start..stop
S start..stop
CclPrx105 743 0 1..363 1..363
MtPrx100 429 2e-151 62..361 47..343
MePrx118 429 4e-151 12..362 7..346
GmPrx64 428 6e-151 62..361 45..342
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1152131..1152466 336 N° 2 1152566..1152908 343 N° 3 1153010..1153419 410  
join(1152131..1152466,1152566..1152908,1153010..1153419)


exon

Literature and cross-references CsPrx16 (orange1.1g044134m/Cs2g11900/)
DNA ref. Citrus sinensis Annotation Project:   chr2 (8903883..8905174) Phytozome 12:   scaffold00008 (1152131..1153419)
Protein sequence: CsPrx16 (orange1.1g044134m/Cs2g11900/)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   363 (338)
PWM (Da):   %s   40431.28 (37622.8) Transmb domain:   %s   i5-27o
PI (pH):   %s   5.48 (5.48) Peptide Signal:   %s   cut: 26 range:26-363
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNYSSSISFFFFIILLVQLISISSAAYNEQDQNKKSPLDVDLPVGDIGLDDSFASSEILHSDEWPSSSYYHRRCPNKNVEKIINKKVKEWVDKDYKIAPSLLRLHYHDCAVRGCDGSILLNNDGSERRANVSKTLRGFEVIDDIKAELEKECPKTVSCADILAAAARDATVLLGGEYWDVPLGRKDGRVSIGKEADIVPMGHDNVTTLLEFFQSMGLEVSDLVILSGAHTIGRTSCAQVQDRIYNYKGTGKPDPSINEKYLNFLQRRCRWASEDAELDAESPWKFDNMYYKNLQNGLGLLPTDQLLLSDKRTEPIAKALASMPSFLYGQIFGASMKKFGKVNVLSGDEGEIRTNCNFVNSHS

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 3).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTACTCCTCTTCTATTTCTTTCTTCTTCTTCATCATTCTTCTTGTTCAGTTGATTTCAATCTCATCAGCAGCCTACAATGAGCAAGATCAAAATAAAAAATCCCCGTTGGATGTT
GACCTCCCAGTTGGTGATATCGGTTTAGACGACAGTTTTGCATCGTCAGAGATCTTGCATTCCGACGAATGGCCATCCTCCTCTTACTATCATCGGAGGTGTCCAAATAAAAACGTTGAA
AAAATCATCAATAAAAAGGTTAAAGAATGGGTTGACAAGGATTACAAAATTGCTCCCAGCCTTCTAAGGTTGCACTACCACGACTGCGCAGTTAGG
GTAAGAAAATAGTATCTCTTTTTT
TCTTTTATTAAAACGTTAAGTAATTTTTAAAATAACATACTAAAAAACAATGTGTCATTTTAACTAATAATGCAGGGATGTGATGGTTCAATTCTTTTGAACAACGACGGAAGCGAAAGA
AGGGCTAATGTAAGCAAAACACTGAGAGGGTTCGAGGTGATCGATGATATCAAGGCGGAGCTGGAGAAGGAATGCCCGAAAACCGTCTCCTGTGCCGACATTCTGGCAGCGGCCGCCAGG
GACGCCACCGTGCTTCTTGGTGGTGAATACTGGGACGTTCCCTTAGGAAGGAAAGACGGGCGAGTGTCTATTGGCAAGGAAGCTGACATTGTGCCAATGGGTCACGACAATGTTACCACC
CTGCTCGAGTTTTTCCAATCTATGGGATTAGAAGTGTCCGATTTGGTTATTCTCTCAG
GTAATTCCAAAGATATATATATATATATTTTAAGTTCACGAGAGTTCAGAAATTATGAATTT
ATTACTTAAGTGTTAATGTGTATATTTTTCTCTCTCCAGGGGCACATACAATCGGTAGGACATCATGTGCACAAGTTCAGGACAGGATTTACAATTACAAAGGGACAGGGAAACCGGATC
CCTCCATTAATGAAAAATACCTCAACTTCTTGCAAAGAAGATGCAGATGGGCATCAGAAGATGCTGAATTGGATGCTGAAAGTCCCTGGAAATTTGACAACATGTACTATAAAAATCTTC
AAAACGGCTTGGGGCTGCTACCAACAGATCAACTCTTGCTCTCTGATAAAAGGACTGAACCCATTGCTAAAGCGTTGGCTAGCATGCCATCCTTCCTCTACGGCCAAATATTCGGGGCCT
CCATGAAAAAATTTGGCAAAGTTAATGTTTTATCAGGAGATGAAGGAGAAATCCGCACCAATTGCAATTTTGTCAATTCTCATAGCTAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTACTCCTCTTCTATTTCTTTCTTCTTCTTCATCATTCTTCTTGTTCAGTTGATTTCAATCTCATCAGCAGCCTACAATGAGCAAGATCAAAATAAAAAATCCCCGTTGGATGTT
GACCTCCCAGTTGGTGATATCGGTTTAGACGACAGTTTTGCATCGTCAGAGATCTTGCATTCCGACGAATGGCCATCCTCCTCTTACTATCATCGGAGGTGTCCAAATAAAAACGTTGAA
AAAATCATCAATAAAAAGGTTAAAGAATGGGTTGACAAGGATTACAAAATTGCTCCCAGCCTTCTAAGGTTGCACTACCACGACTGCGCAGTTAGG
GGATGTGATGGTTCAATTCTTTTG
AACAACGACGGAAGCGAAAGAAGGGCTAATGTAAGCAAAACACTGAGAGGGTTCGAGGTGATCGATGATATCAAGGCGGAGCTGGAGAAGGAATGCCCGAAAACCGTCTCCTGTGCCGAC
ATTCTGGCAGCGGCCGCCAGGGACGCCACCGTGCTTCTTGGTGGTGAATACTGGGACGTTCCCTTAGGAAGGAAAGACGGGCGAGTGTCTATTGGCAAGGAAGCTGACATTGTGCCAATG
GGTCACGACAATGTTACCACCCTGCTCGAGTTTTTCCAATCTATGGGATTAGAAGTGTCCGATTTGGTTATTCTCTCAG
GGGCACATACAATCGGTAGGACATCATGTGCACAAGTTCAG
GACAGGATTTACAATTACAAAGGGACAGGGAAACCGGATCCCTCCATTAATGAAAAATACCTCAACTTCTTGCAAAGAAGATGCAGATGGGCATCAGAAGATGCTGAATTGGATGCTGAA
AGTCCCTGGAAATTTGACAACATGTACTATAAAAATCTTCAAAACGGCTTGGGGCTGCTACCAACAGATCAACTCTTGCTCTCTGATAAAAGGACTGAACCCATTGCTAAAGCGTTGGCT
AGCATGCCATCCTTCCTCTACGGCCAAATATTCGGGGCCTCCATGAAAAAATTTGGCAAAGTTAATGTTTTATCAGGAGATGAAGGAGAAATCCGCACCAATTGCAATTTTGTCAATTCT
CATAGCTAT

Retrieve as FASTA