Entry information : CsPrx31 (orange1.1g045265m/Cs5g23280)
Entry ID 8886
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-05 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx31 (orange1.1g045265m/Cs5g23280)
Name (synonym) CsPrx31 (orange1.1g045265m/Cs5g23280)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx31
start..stop
S start..stop
CclPrx88 691 0 9..345 1..337
PpePrx77 505 0 1..338 3..341
GrPrx02 505 0 7..338 8..337
BrPrx61-1Aa_other 504 0 6..340 3..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 22987..23238 252 N° 2 21929..22108 180 N° 3 21423..21582 160 N° 4 20620..21062 443
complement(join(20620..21062,21423..21582,21929..22108,22987..23238))


exon

Literature and cross-references CsPrx31 (orange1.1g045265m/Cs5g23280)
DNA ref. Citrus sinensis Annotation Project:   chr5 (26011718..26014332) Phytozome 12:   scaffold00403 (23238..20620)
Protein sequence: CsPrx31 (orange1.1g045265m/Cs5g23280)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   345 (318)
PWM (Da):   %s   38336.25 (35509.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.04 (8.20) Peptide Signal:   %s   cut: 28 range:28-345
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSDPRFVMILPLLALALSLFVANADAAVSLPQPVKLEWHYYKVHNTCDDAEAYIRHQVELFYKHDKTIAPKLLRLLYSDCFVTGCDASILLDRPNSEKTAPQNWGLGAFVLIDKIKVVLEQRCPGAVSCSDILNLATRDAVHMAGAPSYPVFTGRRDGMTSTKESVDLPSPSISWKESLACFQSKGLDVQDMVTLLGAHTMGQTRCRYIVDRLYNYKNTGKPDPSMNTTLLNRLRKECPPRTRKGQSDPLVYLNPETGSSYRFSESYYSRVKTHEAVLGVDQQLSNGDNNTLQIVDEFAAGFEDFRKALALSMSRMGSINVLTGKQGEIRRNCRCTNADTNCK

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Containing motif 'YSDC'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTAGCGATCCACGGTTCGTGATGATTCTCCCACTGTTGGCTCTGGCACTGAGCTTGTTTGTGGCCAACGCCGATGCGGCGGTGTCTCTGCCGCAGCCGGTGAAATTGGAATGGCAC
TATTACAAGGTTCATAATACATGCGATGATGCAGAGGCATATATCAGGCACCAAGTGGAGCTGTTCTACAAACACGATAAAACCATCGCCCCTAAACTCCTCCGTTTGCTCTACTCTGAC
TGCTTTGTAACT
GTATGTCTCTTTATCATTTTTTCCTTTCTAAATTTTGCCCTTTTTATTTCTGATCTTTACTTATCATTTTGTTTTAACTCTAGAGAATTTTGATTAGAAATTGCTTTT
TACTAGCTTGGTTCTTTCTTCAGAAGCACTTGGCAGTTTTTCCGGGAGAAGCTGTTTAAGGAAATACTGAAATGCTTCTCTATTCCAAGCAATAGCTTCTTGGAAAAGAACATGATATGT
GTATTTTCATTGATGCTCGGCTGTATAGGAACTTGCTATCGCTTATTATAAGCTGATTTTACGGGAAAATGATGAAAACTCTTTTAGTAAATTAGTCATTTCTCTCCTCACTTTTCAAAA
CTCGTCAAAATTTTCCTGCGGTTAAAAAAAAAAGGGTCAACTTTCAATTATTTATTTCTACTATTTTATCTCTGAATTGATGAAACCCACAATCGATTGACAAAAACTTCTAAGACAGAA
ATTAATTGATGAAAATTTCAAAAGACAATAATTTTTTTTTAAATACTTTAGAACATGAGAAAAAAAAATGATTAGTTTCGGCTTTTGATAATTTTCTCCTGATTTTACCAAAAGTATGCG
CTCTGAACGTGGTTTAATGCTAAAGCAAACAATTAATCTTACTGGTATAAGTTACAGGTGGCCTAAACATTTTTCAGATTTTGCCCCAATTATTAATTTCACAGAACATGGCCTTGGCGT
CGCCGGCAAGCATGCCCAGCAATTTCTATGTTTCTCTTTAATAACGTAACTATGCTCAGGATAATGTGCTCCATATTTTATGTTTCGTGCTATCACAAAAATTTTACCTATGCAATTGAA
TGTTAAATTTATGGTGATTTTACGTTGATATCGTGATTTGCTAAATCCAGGGATGTGATGCATCAATTCTGCTTGATAGACCAAACTCAGAAAAGACTGCACCACAAAACTGGGGACTTG
GGGCGTTCGTTCTCATCGACAAGATCAAAGTTGTTCTTGAACAACGCTGCCCAGGTGCCGTCTCTTGTTCCGATATACTCAACCTTGCCACCAGGGATGCCGTTCACATG
GTATGCGTTT
TTATTTTGCTTCCCCTATATTTTATGTAATTTTTTGTATTCCACTATAAATTGCAAACTTATTTCCGGGTAATTTAACGCTCAAACAGTCACGACGAGGTTTTCAAGTAACCATTTTTGA
CCGGCCACCCTAAGCTCGAATCCTAGGGAGATTGGGGGTTTAAAAAAGTCAATTCGGATTTCGCCCACCCCTACGTCTTAGAAAAATAAACAATCAATTGAAAAGGCATAAAATTTAAAA
AATACAGATGCAGGCACCGTAAGGGCATATTGAGGAATTGCCACCATTTATAAGTTGTTAACTAAGTCACTAATTCATATTTTGATGAATCAACAGGCAGGCGCACCATCTTATCCTGTG
TTTACAGGAAGAAGGGACGGTATGACATCAACCAAAGAATCTGTAGACCTCCCATCACCGTCCATCTCATGGAAAGAATCTTTGGCATGCTTCCAATCCAAAGGTTTAGATGTGCAGGAC
ATGGTAACCCTCCTAG
GTAAGGTTCTCTAATACCTCAAAAGAATCTATTAAACGAACCAATAAAACCAGCGAAAGTAAGAAAAGCTAAAACCCCCCAAACAAAAAAATTCAGAGATTTAA
CAGTACAAACACTGTATGAATCTCAGTTGCATTTGCTGATGGAGAAAATCAGAAATATATTTCCTAAGCAGGAAATATGAAAAGGTAGTTCAAAATATGTAAAAGCCTGAACTCACGTTC
TCCATCTCAGGGAGAAAAAAAATTTCTAAAATTCTCTGTATAAGCTACCATTCATCACTTTGTTAATTCAGTGAATTCTTTCCATTTCACCCGGTACCGTTCTTCACTTAAAATAACTTT
TCTTCCTCTATTTCAGGAGCACACACAATGGGCCAAACTCGATGCCGCTACATTGTTGACCGGCTCTACAATTACAAAAATACTGGAAAGCCAGACCCAAGTATGAACACAACACTTTTA
AATCGACTGAGAAAGGAGTGTCCACCCAGAACAAGAAAGGGTCAATCTGATCCACTTGTTTATCTAAACCCAGAAACTGGCTCCAGTTACAGATTTTCTGAGTCCTACTACTCCAGAGTT
AAGACACATGAAGCAGTTCTTGGAGTTGATCAGCAGTTATCCAATGGTGATAACAACACACTTCAAATTGTTGATGAATTTGCTGCTGGTTTTGAAGATTTTAGGAAAGCATTAGCTCTG
TCAATGAGTCGGATGGGCAGCATTAATGTTTTGACTGGGAAGCAGGGGGAGATACGCAGAAATTGCCGATGCACAAATGCAGATACTAATTGCAAAAGG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTAGCGATCCACGGTTCGTGATGATTCTCCCACTGTTGGCTCTGGCACTGAGCTTGTTTGTGGCCAACGCCGATGCGGCGGTGTCTCTGCCGCAGCCGGTGAAATTGGAATGGCAC
TATTACAAGGTTCATAATACATGCGATGATGCAGAGGCATATATCAGGCACCAAGTGGAGCTGTTCTACAAACACGATAAAACCATCGCCCCTAAACTCCTCCGTTTGCTCTACTCTGAC
TGCTTTGTAACT
GGATGTGATGCATCAATTCTGCTTGATAGACCAAACTCAGAAAAGACTGCACCACAAAACTGGGGACTTGGGGCGTTCGTTCTCATCGACAAGATCAAAGTTGTTCTT
GAACAACGCTGCCCAGGTGCCGTCTCTTGTTCCGATATACTCAACCTTGCCACCAGGGATGCCGTTCACATG
GCAGGCGCACCATCTTATCCTGTGTTTACAGGAAGAAGGGACGGTATG
ACATCAACCAAAGAATCTGTAGACCTCCCATCACCGTCCATCTCATGGAAAGAATCTTTGGCATGCTTCCAATCCAAAGGTTTAGATGTGCAGGACATGGTAACCCTCCTAG
GAGCACAC
ACAATGGGCCAAACTCGATGCCGCTACATTGTTGACCGGCTCTACAATTACAAAAATACTGGAAAGCCAGACCCAAGTATGAACACAACACTTTTAAATCGACTGAGAAAGGAGTGTCCA
CCCAGAACAAGAAAGGGTCAATCTGATCCACTTGTTTATCTAAACCCAGAAACTGGCTCCAGTTACAGATTTTCTGAGTCCTACTACTCCAGAGTTAAGACACATGAAGCAGTTCTTGGA
GTTGATCAGCAGTTATCCAATGGTGATAACAACACACTTCAAATTGTTGATGAATTTGCTGCTGGTTTTGAAGATTTTAGGAAAGCATTAGCTCTGTCAATGAGTCGGATGGGCAGCATT
AATGTTTTGACTGGGAAGCAGGGGGAGATACGCAGAAATTGCCGATGCACAAATGCAGATACTAATTGCAAAAGG

Retrieve as FASTA