Entry information : CsPrx51 (orange1.1g045752m/orange1.1t02038)
Entry ID 8888
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2016-09-08 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx51 (orange1.1g045752m/orange1.1t02038)
Name (synonym) CsPrx51 (orange1.1g045752m/orange1.1t02038)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx51
start..stop
S start..stop
CclPrx111 521 0 130..390 71..331
CclPrx31 508 0 130..390 71..332
CsPrx50 506 0 130..390 71..332
GrPrx41 396 4.87e-138 130..386 73..332
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8888' 'join(1..396,2773..2955,3457..3619,3905..4335)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..396 394 N° 2 2773..2955 181 N° 3 3457..3619 161 N° 4 3905..4335 429
join(1..396,2773..2955,3457..3619,3905..4335)


exon

Literature and cross-references CsPrx51 (orange1.1g045752m/orange1.1t02038)
DNA ref. Citrus sinensis Annotation Project:   chrUn (32181455..32185789) Phytozome 12:   scaffold01263 (27939..29498)
Protein sequence: CsPrx51 (orange1.1g045752m/orange1.1t02038)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   390
PWM (Da):   %s   41886.78  
PI (pH):   %s   6.93
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MWIKVVTVGGRSRKHHIKEKWNRDNGKSVSNAANSKHHDCSQQPQQSQSNPIDKTKSRLDQEEMGQNYELAIGDEVERVCEKHLMNGVLEITMAQQAGGKTQHEIEGNARGPGNMGIQAR
NKNVKNKREILE
GCDASVLLDGSDSEKFAAPNRNSARGFEVIDAIKTAVEGQCSGVVSCADILAIAARDSVLLSGGPTWKVLLGRRDGLVANQTGANALPSPFEGLNILTAKFAAVGLNI
KDLVSLS
GAHTIGFAKCAFFSNRLSNFSGTGAPDATMDTSLVSELQSLCANGDGNNTTPLDRNSIDLFDNHYFQNLINNKGLLSSDQILYSSDEAKSTTESLVESYSSNSNLFFANFVNS
MIKMGNVSPLTGTNGEIRKNCRAVNSLTEI

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from Phytozome (Exon 1 is missing). Correct prediction frm citrus annotation project.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGGATTAAGGTAGTTACAGTGGGAGGACGCTCAAGGAAGCACCATATCAAGGAGAAATGGAATAGGGATAATGGCAAATCAGTGAGTAATGCGGCAAACTCAAAACACCACGACTGC
TCACAACAACCTCAGCAGAGTCAAAGTAACCCGATTGACAAAACCAAATCAAGACTCGATCAGGAAGAAATGGGTCAAAATTATGAATTAGCTATAGGTGATGAGGTGGAACGAGTATGT
GAGAAACATTTAATGAATGGTGTATTGGAAATAACAATGGCACAACAAGCAGGCGGCAAAACGCAGCATGAGATAGAGGGAAACGCAAGAGGACCTGGAAATATGGGAATTCAGGCGAGA
AATAAAAATGTTAAAAACAAGCGAGAAATTTTGGAG
AGGTAACACCAATTAAAGTTTATAAGGAGATACTGTGCTAAGAAGGCGCGAATGAAGCAAAGACAGGAAATTAGTCTCGAAGAG
CTCCAATGAGGCCCAATAGAAGGAAATGGAAATTACAAGTTCGAAACACAAACTCCAATGGTGGAAACAAATATGGGTTAGGGGCGTTAAAAAGGCCAAGTTGTGAGCTAACTGAGCCAA
GTTCAAAACAAAAGAAGATGAAAGTGACTAGCCTACCCAAATTAGAAACAAAGCAATATCAGCTAAATTCACCAGTGGCAAAACTCAATTTGAGCTGGGAACTGTTGGCAATTAAGGGAA
TAGAAATTGCAGACTCAAACATAGAAGAGATATCGGTGGAGGCTGGCGATCAAGAATGCTAGAAGCCATGAAAATCCTCAGCTGGAATGTTTAGGGTTTAGGGAATTCCCGGATGTTCCT
AGCAATGCAACAAATTCTCCAAATTCATAGACCTCAACTTGTGTTTTTGAGTGAGACAAAGTTGCAATCTATGCAAATGGATACGATTCGTAGTAAGCTAAATTTTGATAGCTGTTTTGC
TGTGGATAGTAGTGGAAGGGGAAGAGGTCTTGCAATGCTTTGGAACTTTGAAATTTGTGTGCATATTAAGTCATTTAGCAAGCACCACATTGATGCTGAACAACAAATGGGCAATGAAAA
GCAAATGCGATGTACAGAGGTGTATGGACATCCGGAGATGCAGCAAAAAAAGCACACATGGACATTGTTGAGACGGCTATTAGGTTTATCTTCCACACCTTAGTTATGTTTCGGTGATTT
TAATGAAATTTTACACCTATATAAGATGAATGGTGGCAATGATAGAAATCCAAACCAAATTAGTGACTTCAGAAAAGCCTTGAGAGATTGGAATCTAAAGGATGTGGGCTACATGAGATA
TCTATTTACATAGGATAATGTAATATTTGGCCCTGACTTTGTGGAAGAAAGATTAGACAGATTTTTATGCAATGAGGCTTGAAGTGAGAGATTTATTGAATATGTAGCTGCTAATCTCGA
GAGTTGGATATTCGATCACAACCCAGTGTTGATGGATGTTCAGGATAGAGGTAATGACTTGAATTATCAAAGAAGGAGAACTTCACGAATCCATTATTAAGATATGTGGAGTTCATATGA
CACCTGTAAAAGTATAATTGAAGAAGAATGGCATAAACATGGATGCTGGAACATTGATGATCCCATACATTTATCCCAGAAGGCGACTAAAGATTCCATGGCTACTTTGACTTTGTGTAG
TAAGGAAGAATTTAAAGGGAGAGAAAATAAACTGAAGAAGTTGAAAAAACAGTTGTAGAGCTTAAAGGAAAAAAAGGTGCAGTATGAATTTGAGGATGAAATTAAATGGGTGGAGAGACA
TATTCATAACATATTGGCCGATGAAGAGATTTTCTGGAAACAGCAATCGAGAGCGGATCGGCTTAAAGAGGGGGATAAGAACACTAAGTTTCTCCATCATAAAGCCTTATCGCGGAAGAA
AAAGAATAGAATATGGGGAATTGAAGATGAAACAAGAAGATGGATTGAGAATGTGGAAGAAATGGAGTATGAGTTTTGCACTTATTTCACAAATCTGTTCACCACATCCAGACCGAGCTA
GAACCAAATAGCAGCAGCTCTTTCAAGGATAACACTAAGGCTCTCAAATGACATGAACGAGAAATTGGACAAGCCTTTCTCAACAGAGGCAGTTGTTGAAGCCTTAGCACAGATGTGTCC
AACAAAGACTCTAGGGCCTGATGGGTTGCTAGCAGTCTTTTATAAAAAAACATTGGAAAACGATTAAATCCGGAGTTATCACTACTTGATGTGCCAAGCATATATCTTAAGTGTTCAAAA
GTTACTGTAGATTGTTGGGCACCTGCCTTTAAGCTTTCACTAATATTAAGTCAAATTGGCAGTTCAGTATGATCCACAGCATATATATTTGACCTAAATGTCTCCTGCTCGAATATTTTC
GAATACAAATTAAATATAATTTGCACATAATTGTATGAGTTGTTTGGATTTAATTCACGTGACATATCTAAAGAAGACTTGTGAAAAAGAATGAATGATATACCAAACTCAAAAATGATT
TTTTAGTTTAATTCATGAGTCAAGACTAACATATTATAGTTTCATTTTTATTCTTTTTTGGATCAAGTACTTATATATTCTCAGTTCAAGCAGCTTTAATCTTGCATTGCACGGCTAAAA
GTATAGTATACTGTACACTAGTTTATGAATAAATAAAATGTATGTATCATTAATTTTACTATCATTTTTTCCGTAAATTATTCATCATTTGGTAATTATAATTATTATAAACTTGATCTC
CTTCTTTGTTATAGGGTTGTGATGCATCAGTGTTATTGGATGGAAGTGACAGTGAGAAGTTTGCCGCGCCTAACCGGAACTCAGCACGAGGATTTGAAGTTATTGACGCAATAAAAACTG
CCGTGGAAGGTCAATGCAGTGGAGTTGTATCATGTGCTGATATTTTAGCCATAGCTGCAAGAGATTCAGTGCTCTTG
TGGTAAGTTGGTTGATTAATTGTTCTTCTCATATAGATTCCAT
GGGACTAAAAGAAATAGAGACGTGAGAAACTTGAGACCTTGTTTGATATTGGGATTTCATATTTTTTAAGCCACAGCTACTATAGAAAAAAGTAGCAACTATAGAATAAAGGTTGATAAT
GTATAGTAAATATAGTTTTCAATAATAATTTTGACAAAAACAATAGAGATATTATAAAATTTTCATCATAATAATTTGAGACAAAATTATCTTAATTTTAAAGTCACTAGAACAATTGTT
TACCAAATACTTTAGTATTGTGTCTTAAAAGATAGAACTGTTGAACTAAATTATCAAGCAGGGACTAAGTCATCTTAGTTCACAGGATTCTACCAATTAATAGATAAAGATTTTTTTTTT
TCATATTCTAATGGTATGAGAAAATTAAAATTTTCTCTTTATATTTGAACTTTATGAGGTTAACTTTTACTTATACAAATACTATGACAATATTTTGCAGAGTGGAGGACCTACATGGAA
AGTTCTGCTGGGAAGAAGAGATGGACTGGTGGCAAACCAGACAGGTGCTAATGCTCTTCCTTCACCGTTTGAGGGGCTAAACATTCTCACTGCCAAGTTTGCAGCCGTGGGTCTAAATAT
TAAAGACCTAGTGTCCTTGTCAG
AGGTAATTTATTTGACCTCTCTATCACCATATATTTGTATCAACTCATAACTAATTAGCCTTCGTTCGGGATCACTTTAAATCGTAAAGTAATGACA
TTCTATATAAATTTGGCTCCTCTACTAGTTTAACTTATTTAAAATTATTAAAATAAGAAAATTATCATTTATCTATCCGAAATTTTCTCAATGTTTGAAAAATATCCCAAAAGTTTGCAT
TAGGAATCCCAGGACCCCTTTTTGAACTCCCATAATGTGCGAGCTTGGTAATTTTAATGTTTATGTGCAGGTGCTCATACAATTGGATTCGCAAAATGTGCCTTCTTCAGCAATAGACTA
TCCAACTTCTCAGGAACAGGTGCTCCAGACGCTACAATGGACACAAGCTTGGTGTCCGAATTGCAGAGCCTATGTGCGAACGGGGACGGAAACAATACGACGCCGCTTGATCGGAACTCG
ATTGATCTATTTGACAACCATTACTTCCAGAACTTGATCAACAATAAGGGCCTTCTTAGTTCTGATCAAATTCTATACTCTAGTGATGAGGCCAAATCAACTACTGAGAGTCTTGTTGAA
AGCTATAGCAGCAACTCAAATCTTTTCTTTGCTAATTTTGTTAATTCTATGATCAAAATGGGGAATGTAAGTCCACTCACTGGGACTAATGGTGAGATTAGGAAGAACTGCAGGGCAGTT
AATTCCTTAACTGAGATATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGGATTAAGGTAGTTACAGTGGGAGGACGCTCAAGGAAGCACCATATCAAGGAGAAATGGAATAGGGATAATGGCAAATCAGTGAGTAATGCGGCAAACTCAAAACACCACGACTGC
TCACAACAACCTCAGCAGAGTCAAAGTAACCCGATTGACAAAACCAAATCAAGACTCGATCAGGAAGAAATGGGTCAAAATTATGAATTAGCTATAGGTGATGAGGTGGAACGAGTATGT
GAGAAACATTTAATGAATGGTGTATTGGAAATAACAATGGCACAACAAGCAGGCGGCAAAACGCAGCATGAGATAGAGGGAAACGCAAGAGGACCTGGAAATATGGGAATTCAGGCGAGA
AATAAAAATGTTAAAAACAAGCGAGAAATTTTGGAG
GGTTGTGATGCATCAGTGTTATTGGATGGAAGTGACAGTGAGAAGTTTGCCGCGCCTAACCGGAACTCAGCACGAGGATTTGAA
GTTATTGACGCAATAAAAACTGCCGTGGAAGGTCAATGCAGTGGAGTTGTATCATGTGCTGATATTTTAGCCATAGCTGCAAGAGATTCAGTGCTCTTG
AGTGGAGGACCTACATGGAAA
GTTCTGCTGGGAAGAAGAGATGGACTGGTGGCAAACCAGACAGGTGCTAATGCTCTTCCTTCACCGTTTGAGGGGCTAAACATTCTCACTGCCAAGTTTGCAGCCGTGGGTCTAAATATT
AAAGACCTAGTGTCCTTGTCAG
GTGCTCATACAATTGGATTCGCAAAATGTGCCTTCTTCAGCAATAGACTATCCAACTTCTCAGGAACAGGTGCTCCAGACGCTACAATGGACACAAGC
TTGGTGTCCGAATTGCAGAGCCTATGTGCGAACGGGGACGGAAACAATACGACGCCGCTTGATCGGAACTCGATTGATCTATTTGACAACCATTACTTCCAGAACTTGATCAACAATAAG
GGCCTTCTTAGTTCTGATCAAATTCTATACTCTAGTGATGAGGCCAAATCAACTACTGAGAGTCTTGTTGAAAGCTATAGCAGCAACTCAAATCTTTTCTTTGCTAATTTTGTTAATTCT
ATGATCAAAATGGGGAATGTAAGTCCACTCACTGGGACTAATGGTGAGATTAGGAAGAACTGCAGGGCAGTTAATTCCTTAACTGAGATATGA

Retrieve as FASTA