Entry information : CsPrx55 (orange1.1g047796m)
Entry ID 8890
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx55 (orange1.1g047796m)
Name (synonym) CsPrx55 (orange1.1g047796m)
Class Class III peroxidase    [Orthogroup: Prx039]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx55
start..stop
S start..stop
CclPrx114 625 0 1..322 1..322
CclPrx20 583 0 1..321 1..321
CsPrx53 581 0 1..321 1..321
CppPrx02 567 0 10..321 1..312
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16011..16255 245 N° 2 16935..17097 163 N° 3 21158..21326 169 N° 4 21506..21894 389
join(16011..16255,16935..17097,21158..21326,21506..21894)


exon

Literature and cross-references CsPrx55 (orange1.1g047796m)
DNA ref. Phytozome 12:   scaffold01263 (16011..21894)
Protein sequence: CsPrx55 (orange1.1g047796m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (297)
PWM (Da):   %s   35151.03 (32592.6)  
PI (pH):   %s   8.94 (8.95) Peptide Signal:   %s   cut: 26 range:26-322
Sequence 363
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLRYLLAAALVVAFVLEGSPSQAQLSPSFYSSTCPNVLNIIEDVLKKAFSSDIRIGASLIRLHFHDCFVDVSNLCSLIFHTKNIDSEKFAAPNNNSARGFEVIDNMKAAVEKACPRVVSCADILTIAAERSVALSGGPSWAVPLGRRDSRTANRALANQKLPGPSDTLDVLKSSFRNVGCNDNFDLVALSGAHTFGRAQCRFFRGRLYDFNNTGKPDPTLDRTLLKQLRELCPQGGNGGVLANFDVKTPDVFDNKYFSNLRLRKGLLQSDQELFSTPGADTAAIVEDFGRNQNAFFKNFVTSMIRMGNLKPLQEIKGRLD

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (3' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTTCACTTCGTTATCTTCTTGCAGCAGCTCTTGTTGTTGCTTTTGTGCTTGAGGGATCACCATCTCAAGCTCAACTTTCTCCCTCTTTTTATTCTTCCACATGCCCTAATGTATTGA
ACATTATCGAGGATGTGCTTAAGAAAGCTTTCTCGTCCGATATCCGCATCGGTGCCAGCCTCATCAGGCTTCATTTCCATGACTGTTTTGTTGATGTAAGCAATCTCTGCTCTCTCATTT
TTCA
TCTTCTTTACGTTATCAAGCTCTCTGTCTATTTACTTATTGATATAACATAGTTTCAAGCATGTCAATGAACAGTATCTTTATAATTTTTTGTGTCATTAAACAAAATATAGAGTT
TTCATTAAGAGTTTGAATATATCATTTTAATTTCAACAACTTCCAAAACCATTTTCATATATCTTTTTTTTTTCTCTTTTTCTTTTCTCTTTACGACAAATTTTTCCTCTCTAATTCGAT
GTACCGAGGACCATGTAATTCTTTGNNNNNNNNNNNNNNNNNNNNNNNNNTTTTCATGTACTAGAAATTTAAATCTAGCAAAGATTTGGTCCAAAACAGGAATTCAAATCCACCTCATGG
CCTCATCCCTGCTCAGTGCTTTTAATGATCATGGGTCCAATATTAATGGTGTATGGTTGAAAAAAAATCACACTTGTTTTATATTCTTCCAACCGAAAAATTTAAATCAACAGGAAATCC
TAGTCTTAAAAACATATGTAATAATAAGACAATTTAAATAAGAAGAGTTTNNNNNNNNNNNNNNNNNNNNNNGAATTCATGTCCATAAGATAAGAAGGAATCTATCTACTTGTTAAAATA
ACAATATAATGGACTGTTAACATAGCAAGTTGTTAACTAATACTATTTTTTCCGGGGTGTGATGCATCGATTTTGCTGGACAGCACTAAAAACATAGACAGCGAGAAATTTGCTGCGCCA
AATAATAATTCGGCGAGGGGTTTCGAAGTTATTGATAACATGAAAGCTGCCGTTGAAAAGGCATGTCCAAGGGTTGTTTCCTGCGCTGATATTCTTACTATTGCGGCTGAACGATCCGTT
GCTTTG
GTATGAATTTCTTTTACCAACTCCTCTTCCTTATTAATATTTTATGCTTAGAAGTAAATTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNCTCAACCAATATATTAGATAATGAAAATATAAAAAGATAAGAAATAACGATGCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGGTATCAAAATAAGTGAACAGAATAATGGTA
AATCTTTGCAGTATTAATGTAATTTTTAATTATTTTTTCAATTAATAACAACCCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCGTAAGTTCAACTTTAC
CCTTAGAAGAATACATTAATTAAATAATTATTCACATAGAACAATGTGCAAGATCTGAGTCCACATGTTTAGCCTTTGATTTAAGTGAAGAGATTCATAGTTGGACCCATCATTATTAAA
TTGGGACGACGCAATGGACTCCATTATTTAAAAGGTTCGGCTACAGTGCAACTGTGATACTGTGCTACAGTTACATTCAGCCGTTGGATCCACTTAGATGAGTGGAGTCTATTAGAATTT
AATGGCTGGATGCAACAGTAGCACGGTACCATATTTGCACCACAATTTTTCCCTTATTTAAAAGGGGTGACTTATTGACTATGGTGCATCAGCTACACTGTGTGGTACCAAAATTGCTAC
ACATATGTCAATATAGTGATTATTAAGGGATAAATTGTTACTGACAGTGAGACACTTTTTACTGCGCTGGTGCATCGTAGCAAGTCCTTAGTTTTAAACTTAAAAGTTTTCTTCTTTTGT
TATACGACAAAGTTTTGATTCAACGGCTAGCAAATTAAATAGTCCGCCCCAAACGCACATCTCTTAAGATTATTGTTGATTTTGAGTGAATGGCTTTTGGTTACAGTCAGGGGGTCCGTC
ATGGGCAGTTCCATTGGGAAGAAGGGACAGCAGAACAGCAAACAGAGCTCTTGCAAATCAGAAACTTCCAGGACCATCTGATACTCTTGATGTGCTCAAATCTAGTTTTAGAAATGTTGG
CTGCAATGACAATTTTGATCTTGTTGCACTCTCCG
GTAATTATTAATTGCTTCTGCATCCTTTTAATTACTTGAGTAAAGTTATGGGAGTAGACTTTTAAAAGTCAAAAGAGCATGGTAC
TAGCAACGCACGCTCAAAAATTAATTTAAGAAATGAGTGTTATGCCTTAAATTTATGTATACTTAACTCAAAATTGGGCATGCATGTTTTTCAGGAGCTCACACGTTTGGTAGGGCTCAG
TGCCGATTTTTCAGGGGCAGATTATACGATTTCAACAACACTGGCAAGCCAGACCCGACACTGGACAGAACCCTGTTAAAGCAACTGAGGGAACTATGCCCACAAGGTGGAAACGGCGGC
GTTCTTGCTAATTTTGATGTCAAAACACCTGATGTTTTCGACAACAAATACTTCTCCAATCTTAGACTCCGCAAAGGCCTTCTGCAGAGTGATCAAGAGTTGTTTTCGACTCCTGGTGCC
GATACCGCTGCCATTGTCGAGGACTTTGGGAGGAACCAGAATGCTTTCTTTAAAAACTTTGTGACCTCAATGATAAGAATGGGCAATTTGAAACCACTGCAGGAAATCAAGGGGAGATTA
GAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTTCACTTCGTTATCTTCTTGCAGCAGCTCTTGTTGTTGCTTTTGTGCTTGAGGGATCACCATCTCAAGCTCAACTTTCTCCCTCTTTTTATTCTTCCACATGCCCTAATGTATTGA
ACATTATCGAGGATGTGCTTAAGAAAGCTTTCTCGTCCGATATCCGCATCGGTGCCAGCCTCATCAGGCTTCATTTCCATGACTGTTTTGTTGATGTAAGCAATCTCTGCTCTCTCATTT
TTCA
CACTAAAAACATAGACAGCGAGAAATTTGCTGCGCCAAATAATAATTCGGCGAGGGGTTTCGAAGTTATTGATAACATGAAAGCTGCCGTTGAAAAGGCATGTCCAAGGGTTGTTT
CCTGCGCTGATATTCTTACTATTGCGGCTGAACGATCCGTTGCTTTG
TCAGGGGGTCCGTCATGGGCAGTTCCATTGGGAAGAAGGGACAGCAGAACAGCAAACAGAGCTCTTGCAAATC
AGAAACTTCCAGGACCATCTGATACTCTTGATGTGCTCAAATCTAGTTTTAGAAATGTTGGCTGCAATGACAATTTTGATCTTGTTGCACTCTCCG
GAGCTCACACGTTTGGTAGGGCTC
AGTGCCGATTTTTCAGGGGCAGATTATACGATTTCAACAACACTGGCAAGCCAGACCCGACACTGGACAGAACCCTGTTAAAGCAACTGAGGGAACTATGCCCACAAGGTGGAAACGGCG
GCGTTCTTGCTAATTTTGATGTCAAAACACCTGATGTTTTCGACAACAAATACTTCTCCAATCTTAGACTCCGCAAAGGCCTTCTGCAGAGTGATCAAGAGTTGTTTTCGACTCCTGGTG
CCGATACCGCTGCCATTGTCGAGGACTTTGGGAGGAACCAGAATGCTTTCTTTAAAAACTTTGTGACCTCAATGATAAGAATGGGCAATTTGAAACCACTGCAGGAAATCAAGGGGAGAT
TAGAT

Retrieve as FASTA