Entry information : CsPrx05 (orange1.1g017040m/Cs1g19540)
Entry ID 8893
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-11-30 (Qiang Li)
Peroxidase information: CsPrx05 (orange1.1g017040m/Cs1g19540)
Name (synonym) CsPrx05 (orange1.1g017040m/Cs1g19540)
Class Class III peroxidase    [Orthogroup: Prx026]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx05
start..stop
S start..stop
CclPrx38 644 0 14..326 1..313
GrPrx39 565 0 7..326 3..323
GhPrx39 564 0 7..326 3..323
MePrx119 545 0 9..326 1..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 459445..459693 249 N° 2 459789..459977 189 N° 3 460165..460327 163 N° 4 460717..461096 380
join(459445..459693,459789..459977,460165..460327,460717..461096)


exon

Literature and cross-references CsPrx05 (orange1.1g017040m/Cs1g19540)
DNA ref. Citrus sinensis Annotation Project:   chr1 (22819124..22821114) Phytozome 12:   scaffold00074 (459445..461096)
Protein sequence: CsPrx05 (orange1.1g017040m/Cs1g19540)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327
PWM (Da):   %s   35860.86 Transmb domain:   %s   i13-35o
PI (pH):   %s   6.15
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLKSRMSLAKLVMAKLLSVFLFMEVIASGFRFGVDGLRMDYYIMTCPFGEQIVKNAVDRALDDDPTLAAALVRMHFHDCFIEGCDGSVLIDSTQDNKAEKDSPGNLSLRGYEVIDDAKNQLEEQCPGVVSCADIIAMAARDAIFWAGGPIYDIPKGRKDGRRSKIEDTINLPFPTFNASELIRAFGQRGFTAQEMVVLSGAHTIGVARCSSFKSRLTGVDPTLDSDFAKTLSKTCSAGDNAEQPFDATRNDFDNLYFNALIRKAGVLFSDQTLLTNAKTRAAVNGYAMNQAMFFLDFQQAMVKMGMVDVKEGGKGEVRHNCRKIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (Extra 5' end has been removed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGTTGAAGTCTCGTATGAGTTTGGCAAAATTAGTAATGGCCAAGTTGCTTAGTGTTTTTTTGTTCATGGAAGTGATAGCAAGTGGTTTTAGGTTCGGAGTTGATGGACTTCGAATG
GATTACTACATCATGACTTGCCCATTTGGTGAACAAATTGTGAAAAATGCTGTCGACAGGGCTCTCGACGATGATCCCACTCTTGCTGCTGCCCTTGTTAGAATGCATTTCCATGACTGT
TTCATTGAG
GTCCTCTAATATTTTTTTTCAGTTTGGTCCTTTCTTTCTTTATTTATTTGATATCATACGAATGAAACTAATGTTTTGTTTTTGTCCTTTTTAAGGGGTGTGACGGGTCAG
TTCTGATTGACTCAACGCAGGACAACAAAGCAGAAAAGGACTCTCCTGGCAATTTGAGCCTGCGGGGCTATGAAGTCATAGATGATGCTAAAAATCAGCTTGAAGAGCAATGTCCAGGCG
TCGTTTCATGTGCCGATATCATTGCTATGGCTGCTAGAGATGCTATTTTTTGG
GTAATGAAATTGATTAAGCCTCTAATGTCGCAATAACATATCATATATATATAACTATCGGCCTTAA
CAATCATACATATACAACTTTGTCACATCAGTTTATATTACTAGTGTTACTGTTACATCATTGCAAATATTGTAGAATACATTTCCAAATATTTATAGGTTATAAATGGTATGTGAACAG

GCCGGGGGTCCAATATACGACATACCAAAAGGAAGAAAGGATGGAAGGAGATCGAAAATAGAGGACACAATCAATCTACCATTTCCCACCTTCAACGCATCAGAGCTCATTCGAGCCTTT
GGCCAGCGTGGCTTCACTGCTCAAGAAATGGTTGTTTTATCAG
GTAATTGTCATTAACACGTCAATTGATAAAAAAATAGTTTCACTAAATGACACCAATATGACAATGATTCGATGAAT
TTGAATGAATGATTTAGCTGTACCGCACCACTATATGTTTCGTGTTATTCGATTGATAATAAATTTCAACCCGTACTGCATATAGGGGTTATATTAAAATATATTAATTATAAAGTATAA
CTAATAATGTTAAACGAGTAATTGATACATATTATTATTTTTTTTTTTTCAAAAAGAGAATTTGTGGGATGTCCGAAATAGAAATGGCAACCACCCACCAAATGAAATTCACATTCAATT
TGAGTAAACAAAGAAGGGAAGTTAATTGTCTAACTCGTGTGTGTAACACTAGTAGACTTGATGGTGAGGCAGGGGCACACACGATAGGGGTGGCCAGATGTTCATCATTCAAAAGTCGGT
TGACCGGCGTCGACCCAACCTTGGATTCCGACTTCGCAAAGACGTTATCAAAGACTTGCAGCGCCGGGGACAACGCGGAGCAACCCTTCGACGCCACCAGAAACGATTTCGACAATCTCT
ACTTCAATGCACTGATCAGAAAAGCGGGGGTTCTGTTTTCGGACCAAACACTGTTGACGAATGCGAAAACCAGAGCAGCTGTCAACGGTTATGCCATGAACCAGGCTATGTTTTTCTTGG
ACTTCCAGCAGGCCATGGTGAAGATGGGCATGGTTGATGTGAAGGAAGGCGGCAAAGGAGAAGTTAGACACAATTGTCGCAAAATAAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGTTGAAGTCTCGTATGAGTTTGGCAAAATTAGTAATGGCCAAGTTGCTTAGTGTTTTTTTGTTCATGGAAGTGATAGCAAGTGGTTTTAGGTTCGGAGTTGATGGACTTCGAATG
GATTACTACATCATGACTTGCCCATTTGGTGAACAAATTGTGAAAAATGCTGTCGACAGGGCTCTCGACGATGATCCCACTCTTGCTGCTGCCCTTGTTAGAATGCATTTCCATGACTGT
TTCATTGAG
GGGTGTGACGGGTCAGTTCTGATTGACTCAACGCAGGACAACAAAGCAGAAAAGGACTCTCCTGGCAATTTGAGCCTGCGGGGCTATGAAGTCATAGATGATGCTAAAAAT
CAGCTTGAAGAGCAATGTCCAGGCGTCGTTTCATGTGCCGATATCATTGCTATGGCTGCTAGAGATGCTATTTTTTGG
GCCGGGGGTCCAATATACGACATACCAAAAGGAAGAAAGGAT
GGAAGGAGATCGAAAATAGAGGACACAATCAATCTACCATTTCCCACCTTCAACGCATCAGAGCTCATTCGAGCCTTTGGCCAGCGTGGCTTCACTGCTCAAGAAATGGTTGTTTTATCA
G
GGGCACACACGATAGGGGTGGCCAGATGTTCATCATTCAAAAGTCGGTTGACCGGCGTCGACCCAACCTTGGATTCCGACTTCGCAAAGACGTTATCAAAGACTTGCAGCGCCGGGGAC
AACGCGGAGCAACCCTTCGACGCCACCAGAAACGATTTCGACAATCTCTACTTCAATGCACTGATCAGAAAAGCGGGGGTTCTGTTTTCGGACCAAACACTGTTGACGAATGCGAAAACC
AGAGCAGCTGTCAACGGTTATGCCATGAACCAGGCTATGTTTTTCTTGGACTTCCAGCAGGCCATGGTGAAGATGGGCATGGTTGATGTGAAGGAAGGCGGCAAAGGAGAAGTTAGACAC
AATTGTCGCAAAATAAATTGA

Retrieve as FASTA