Entry information : CsPrx06 (orange1.1g020412m/Cs1g19890)
Entry ID 8907
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-11-30 (Qiang Li)
Peroxidase information: CsPrx06 (orange1.1g020412m/Cs1g19890)
Name (synonym) CsPrx06 (orange1.1g020412m/Cs1g19890)
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue types Flowers
Fruits
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx06
start..stop
S start..stop
CclPrx39 659 0 1..326 1..326
RcPrx30 555 0 1..326 1..329
TcPrx17 549 0 12..322 13..323
CpapPrx43 547 0 15..326 15..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 571198..571392 195 N° 2 570910..571101 192 N° 3 569612..570205 594  
complement(join(569612..570205,570910..571101,571198..571392))


exon

Literature and cross-references CsPrx06 (orange1.1g020412m/Cs1g19890)
DNA ref. Citrus sinensis Annotation Project:   chr1 (23056698..23059034) Phytozome 12:   scaffold00059 (571392..569612)
EST ref. GenBank:   CK934660.1 [5' end]
Cluster/Prediction ref. UniGene:   Csi.577
Protein sequence: CsPrx06 (orange1.1g020412m/Cs1g19890)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (309)
PWM (Da):   %s   35965.97 (33879.9)  
PI (pH):   %s   4.86 (4.96) Peptide Signal:   %s   cut: 18 range:18-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFWILFFLLLITMATADPLRPGYYSETCPEAESIVGDVIMKAMIREPRSGASVMRFQFHDCFVNGCDASMLLDDTPTMLGEKLSLSNINSLRSYEVIDEVKEALEKACPGTVSCADIIIMASRDAVALSGGPSWEVKLGRKDSLTASQKDADDIMPSPRANASFLVDLFAKFDLSIKDLVALSGSHSIGQGRCFSIMFRLYNQSGSGKPDPAIEPKFREKLNRLCPIGGDGNVTVDLDATPQAFDNQYFKDLAAGRGFLNSDETLYTYPWTRPYVKLYSKDQDKFFKAFVEGMIKLGDLQSGKPGEIRTNCRVVNSRAVDVLLES*

Retrieve as FASTA  
Remarks
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GACCCGGAGC CGATGATGCG GGGATATTGG ACCACTTCAT TGACAAAACT CTGAACTCTG ATGATTTTTT TTGGGTCATC CTGCCACCAA TTTTACCTTA TTGCCCACGA TAATTATTGA  CAATAATCTA AAATTATTAT TACTTGAAAA AATGGTAAAA ATCTCTCGTG GCTGGTCAAA AGTGTTTTGA TTCACTGGAT TTCATGAAGA GCCGAGCGGT CGCATACTTT AGGACGATCG  TTAAGATGTA TACGAATATT TTTTATCGTC TGATTATTTT AATTTTGGAT TTAAGATTTG TTTTTTTTAA GCACCACCGG TTTTTATTAT ATTTAATTTT TCATTTTAAA GCAATTGATT  ATTCGATCCG AGTCAAACTA CTGGCTCAAT TTATCCGTTT TTGCATTTGA TAGGTACAAT GAATAGAGCA ATTATTATCA GTGATAAGAC ATTTTTAATG TTAGATTGAC GTTACTTTTA  CCCATTCACT GCAAAATCGA TAATAATTGA CCATTGCTTG GGAATTCAGC AACGTTTTTT GTGGGACTTT CTCGGGGCTT GTGATGAATT GAAATCAAAT TCAGAGACTA TTGAATTGAA  GGCTAAAAAC ATCATCCAAT TCGATAGCGG CGAGGCATTA GAGAGTGACA CAGCAACCTA TCTATGTTGG ATAATTGTCC GTGATCAAAT ACCTAGAGAA ATGAATTTAG TATAATCTTT  TGATGTGATC ACAGTACGTC CATGATCAAA TTCTTCAACC ACGCAAGTAC TGTTTCATAT TAAATGCTGA TTATACATAT ACAACAACCA AATTTTCATT TAACGAAATA AAAATGATTT  GCTATGAATT AGAAATATAC GTTATAATAA ACTGCCCATT TAGATGTGAA GACCTTATTT AATGATGTGG TTTTAAAGTT ATAGTTCCAA AAAGAGATAG TTTGTGTAAT ATTAATGTTT  TAAAGCTATG GTTCCAAAGT GAAGAAATAT TAGCTATAAA GAGAAAGCAG ATGAGATTTG AGTATTTAAT AAGCATGAAT TTTATTTTAT TTTTCTTTAA ATAAGCAAGG ATAGTATATA  TAATTTTCAT TAAATAATCA TTGAATAAAT TTTAAAATGT TAATCAAATG TTCCAGTACT TTCACATAAA AGCACCGCCG TCAAGCACAA TGCCAACCGT AACTAAGTTG ATTCAAGATG  TATTCAATAA TAAGAGAATA AGTGAAAGTA TATGAAGCAA ATCTTACAAA ATAGTAATAC CAAATATGAT ACCGCATAGA ATGTGTAAAG CACACAATTT TAATCTAATT TATAATCAAA  ATAGAGAATT CATATTTGAA ATTCAAATGG TTGGTTGCTT CCAGACATTA CAAGTAGATC ATTCATAAGC TTCTGTGATA CCATACTTTG AAAATGCTAC GCTTAAAACA GCATCAATAC  CAATTACTAA TAAATTGAAA TGGACATGGA TTGACACAGT GTCTTCCACA AAATACGTGA ATACGGCCTA AACCAGTTGA CCCTTTTTGA AAAGTTAATC AATGGATAAG GCAACAGAAA  GTGGCCGCGT AAATTTTAAT AATTCAGCCA GAAAGCATCA TGGGTGTCGC AATAGTTGAC GCGCTAGAAA GTAATCTAAA TCCAAATCTT CATCAGCCAC TAAAAACTTG AAAAAGGGCC  CAAAATCTGA CCATCCAAAG TTGGTTTCTG TCAGTTAAAC ATCCTTCTCA ATTACTCTCA AGCAAATTGG CCCTCTCCTT GCCTCCTCTT GTCATAACAA GAATGCCCTG TACATTGTTG  ACACCAATTC ACTAAACTTA AAAACAGAAT CCAATCCCTC TCTCCATTCA CAATCACACA CAGCCAAAGA AATTAAAACA GCCTGACACT CGTAAGCCAA ACCGCCCCAC TTCATATTTG 
CTTATAAACT CAACAAAATA CTCATTTTGG ACCTCACCCA CTTCATTCTG CTTATTTTGC TTATTTTGCA AAGCCCAAGA AG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTTTTGGATACTATTCTTCCTTCTACTAATAACCATGGCAACTGCAGACCCTCTCCGGCCTGGATACTACTCGGAGACCTGCCCGGAAGCAGAATCCATCGTCGGAGATGTGATT
ATGAAGGCCATGATTAGAGAACCAAGAAGCGGAGCCTCTGTCATGCGGTTCCAGTTCCATGATTGCTTCGTTAAT
GTAACAACTATACAGAAACCGATTCTCTTATAACAGTGGTAATAA
TAATATGTTTCTAGTCTTGTGGATGATGAATTGTTTATAAAATCTTGACAGGGTTGTGATGCTTCTATGTTGCTTGATGACACACCAACGATGCTTGGAGAAAAATTGTCTCTTTCGAAC
ATTAATTCGCTGAGATCATACGAAGTCATCGATGAGGTCAAAGAAGCATTAGAGAAAGCCTGTCCAGGAACCGTTTCTTGTGCTGATATCATTATCATGGCCTCAAGAGATGCCGTTGCA
CTG
GTAACCCCTAAAAAAAAAATCAATTATTATTATTATTTTTCTTCGAATTAACTTTACCTTAATTTATAATTTAATTTTGGCCAGTCAAAAAATATGGTCGCCCGCAATTAAATAATG
CGAAATGGGTCCTCTCTCCCACTGTCACCTATGTTCTCAAGTTGACAGACATATAATAATCGCCTAATCGTTTTAACTTTAATTCAAAAGTAACAACGCATGATAACGGGTGCAAAAGTT
GGGTTGATTAGAATATGATTTCTTCGTTTTGCCATCTTACAATATATATATATATATATTTTTTTAATTTTATTTTGTCGAGGATGAATGATGCCTAGCTAGATTATCTTGAATTTGCAG
TAATTGCATTCGAATTTTGATATATTTCACTAACGTTGGATCACTGGAAAAATATATCATTTCTAGAAATTTTTTAGTCTATGAAAGCTATAGCTAGATTATAAATTAATAATTTATTGT
CGTTGTCAATTGTTTTGACCCGCATTCATTTAATTACTTTGTGAGTCGGTGATCGGCTACCATTTGCAGGTCGAGAGTAAAACCCTACGTTAAAAATGCATAACATATACTACGACTATC
CAAAATTTTGTTTTCATTTTTTAGTTTTGATCTTTATTTGCAATTTAGTTAATTAACCAGAAGGATGTATGATATGAACAACAAAACTGAGTGGTATCTTGAAACAGAGTGGAGGGCCCA
GCTGGGAAGTGAAGCTGGGAAGAAAAGACAGCTTAACGGCCAGCCAAAAGGATGCGGACGATATCATGCCAAGCCCTAGAGCCAATGCCAGTTTTCTGGTTGACCTGTTTGCCAAATTTG
ATCTCTCCATCAAAGATCTTGTAGCCCTTTCGGGCTCACACTCGATTGGCCAAGGCCGATGTTTTTCGATCATGTTTAGGCTATACAATCAGTCTGGGTCAGGCAAGCCTGACCCTGCCA
TCGAGCCTAAGTTCAGAGAAAAGCTAAACAGGCTTTGTCCAATCGGCGGCGATGGGAATGTAACAGTAGACCTTGATGCAACACCTCAAGCTTTTGATAACCAATATTTCAAGGACTTGG
CTGCCGGTAGAGGATTTCTGAACTCTGATGAGACGCTGTATACTTATCCGTGGACTAGACCATATGTGAAGCTTTATAGCAAAGATCAAGACAAATTTTTCAAGGCATTTGTGGAGGGAA
TGATAAAGTTGGGTGACTTGCAATCCGGGAAGCCTGGGGAGATTAGAACCAACTGTAGAGTTGTTAACAGCCGGGCTGTGGACGTATTGTTGGAATCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTTTTGGATACTATTCTTCCTTCTACTAATAACCATGGCAACTGCAGACCCTCTCCGGCCTGGATACTACTCGGAGACCTGCCCGGAAGCAGAATCCATCGTCGGAGATGTGATT
ATGAAGGCCATGATTAGAGAACCAAGAAGCGGAGCCTCTGTCATGCGGTTCCAGTTCCATGATTGCTTCGTTAAT
GGTTGTGATGCTTCTATGTTGCTTGATGACACACCAACGATGCTT
GGAGAAAAATTGTCTCTTTCGAACATTAATTCGCTGAGATCATACGAAGTCATCGATGAGGTCAAAGAAGCATTAGAGAAAGCCTGTCCAGGAACCGTTTCTTGTGCTGATATCATTATC
ATGGCCTCAAGAGATGCCGTTGCACTG
AGTGGAGGGCCCAGCTGGGAAGTGAAGCTGGGAAGAAAAGACAGCTTAACGGCCAGCCAAAAGGATGCGGACGATATCATGCCAAGCCCTAGA
GCCAATGCCAGTTTTCTGGTTGACCTGTTTGCCAAATTTGATCTCTCCATCAAAGATCTTGTAGCCCTTTCGGGCTCACACTCGATTGGCCAAGGCCGATGTTTTTCGATCATGTTTAGG
CTATACAATCAGTCTGGGTCAGGCAAGCCTGACCCTGCCATCGAGCCTAAGTTCAGAGAAAAGCTAAACAGGCTTTGTCCAATCGGCGGCGATGGGAATGTAACAGTAGACCTTGATGCA
ACACCTCAAGCTTTTGATAACCAATATTTCAAGGACTTGGCTGCCGGTAGAGGATTTCTGAACTCTGATGAGACGCTGTATACTTATCCGTGGACTAGACCATATGTGAAGCTTTATAGC
AAAGATCAAGACAAATTTTTCAAGGCATTTGTGGAGGGAATGATAAAGTTGGGTGACTTGCAATCCGGGAAGCCTGGGGAGATTAGAACCAACTGTAGAGTTGTTAACAGCCGGGCTGTG
GACGTATTGTTGGAATCTTGA

Retrieve as FASTA