Entry information : CsPrx08 (orange1.1g021112m/Cs1g21860)
Entry ID 8916
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-11-30 (Qiang Li)
Peroxidase information: CsPrx08 (orange1.1g021112m/Cs1g21860)
Name (synonym) CsPrx08 (orange1.1g021112m/Cs1g21860)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx08
start..stop
S start..stop
CclPrx32 641 0 1..318 1..332
GhPrx26 499 5.15e-180 24..317 21..330
NnPrx75 498 1.08e-179 4..317 2..330
VvPrx04 495 1.34e-178 15..317 3..321
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8916' 'complement(join(949525..949931,950457..950580,950737..950931,951039..951266))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 951039..951266 226 N° 2 950737..950931 193 N° 3 950457..950580 122 N° 4 949525..949931 405
complement(join(949525..949931,950457..950580,950737..950931,951039..951266))


exon

Literature and cross-references CsPrx08 (orange1.1g021112m/Cs1g21860)
DNA ref. Citrus sinensis Annotation Project:   chr1 (24647426..24649104) Phytozome 12:   scaffold00006 (951266..949525)
Protein sequence: CsPrx08 (orange1.1g021112m/Cs1g21860)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (288)
PWM (Da):   %s   34822.57 (31503.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.47 (8.56) Peptide Signal:   %s   cut: 30 range:30-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGTGRFNFDLIIALSLFLSLCLFPHTILAQLKQDYYAKTCPNVEKIVRTQVEKKFRQTFVTVPATIRLFFHDCFVQGCDASVIIQSDGNNKAEKDHPDNLSLAGDGFDTVVKAKQAVEQV
CKNTVSCADILALATRDVIALSGGPSYSVELGRLDGLSSTASSVSGKLPQPTFNLNQLNSLFAGHTVGFSHCSKFANRIYNFSPQNPVDPTLNKTYATELQQMCPKNVDPRIAINMDPNT
PKTFDNMYFKNLQQGKGLFTSDQVLYTDGRSKPAVDRWASSPADFQTAFITAITKLGRVNVKTGSDGNIRRDCSAFN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCACTGGTCGATTCAATTTCGATCTTATAATCGCTCTGTCTCTTTTTCTAAGTTTGTGCCTGTTCCCCCACACAATATTGGCCCAACTCAAACAAGACTACTACGCCAAAACATGC
CCAAACGTAGAAAAGATTGTCAGAACTCAAGTGGAAAAGAAATTTCGGCAAACTTTTGTCACTGTTCCTGCCACCATCCGTCTCTTCTTCCATGATTGCTTCGTCCAG
GTAACAATAATT
CAGTTATATCTATTTAATTTAAATTAGTGCATTGATTAATTAATTAAAATTAAGATCACCCATCCTCACGACTTATGATATTGGTTCCATTACAGGGGGTTGTGATGCTTCGGTTATAAT
CCAATCAGATGGAAACAACAAAGCGGAGAAAGATCACCCTGATAACCTGTCCTTAGCTGGAGATGGATTCGACACCGTTGTCAAAGCCAAACAAGCAGTTGAACAGGTTTGCAAGAACAC
GGTCTCTTGTGCTGACATCCTCGCCTTGGCCACACGAGACGTCATTGCACTG
GTTGGTATATCTATATACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATACAT
AGGATAGGAAAAGCATGGCTAGTGATTAATGTTGATGTTGGGTTACTAGCTAACTAATTAGTGATTAATAATTATAATAATAATGCAGTCTCAGGTGGACCTTCGTATTCCGTCGAGTTA
GGAAGGCTCGATGGGCTTAGTTCGACGGCTTCAAGTGTAAGTGGGAAGCTGCCTCAGCCGACTTTCAATCTGAATCAGCTCAATTCACTCTTTG
GTGCTAACGGCCTCGACCANNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGACTGACATGATTGCCCTCTCAGGTAACATTTGCCTTTGCCGCCTCAAAACTCAAAAGTTAAAGAACCACGTTC
CAATCATAAATTAATCAACACAATCTCTTCCAACTGGGCCCCACACCAGACGGATTAAATGGGCCACATCTCGTCTGACAGTGTGCTACTTTCGCTTCCGATTTGGATCATTGTTTAGTA
ACATCATCGTATTAGTTGGCAATATCAGTGTCACCGATGCCTTTCTTAGCACTAAGCATCGTTACCAATGTTTTTTTCCACGTACATGCACGTTGATCGTAATTTTGACCGTGATTGAAT
GATGATCTTTGTCTTGCAGCGCGGGACACACCGTTGGATTCTCTCATTGTAGCAAGTTTGCAAATAGGATATACAATTTCAGCCCTCAGAACCCGGTGGACCCGACACTGAACAAGACAT
ATGCGACCGAACTTCAACAAATGTGCCCCAAGAATGTGGACCCCAGGATCGCCATCAACATGGACCCCAACACACCCAAGACCTTTGATAATATGTACTTCAAGAATCTTCAACAAGGCA
AGGGCCTCTTCACCTCCGACCAAGTCCTATATACCGACGGGAGGTCCAAGCCTGCTGTTGATAGATGGGCCTCTAGCCCAGCTGATTTTCAAACGGCCTTTATCACCGCCATTACAAAAT
TGGGCAGGGTCAACGTCAAGACCGGAAGCGATGGGAATATTCGCCGGGATTGTTCAGCCTTTAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCACTGGTCGATTCAATTTCGATCTTATAATCGCTCTGTCTCTTTTTCTAAGTTTGTGCCTGTTCCCCCACACAATATTGGCCCAACTCAAACAAGACTACTACGCCAAAACATGC
CCAAACGTAGAAAAGATTGTCAGAACTCAAGTGGAAAAGAAATTTCGGCAAACTTTTGTCACTGTTCCTGCCACCATCCGTCTCTTCTTCCATGATTGCTTCGTCCAG
GGTTGTGATGCT
TCGGTTATAATCCAATCAGATGGAAACAACAAAGCGGAGAAAGATCACCCTGATAACCTGTCCTTAGCTGGAGATGGATTCGACACCGTTGTCAAAGCCAAACAAGCAGTTGAACAGGTT
TGCAAGAACACGGTCTCTTGTGCTGACATCCTCGCCTTGGCCACACGAGACGTCATTGCACTG
TCAGGTGGACCTTCGTATTCCGTCGAGTTAGGAAGGCTCGATGGGCTTAGTTCGACG
GCTTCAAGTGTAAGTGGGAAGCTGCCTCAGCCGACTTTCAATCTGAATCAGCTCAATTCACTCTTTG
CGGGACACACCGTTGGATTCTCTCATTGTAGCAAGTTTGCAAATAGGATATAC
AATTTCAGCCCTCAGAACCCGGTGGACCCGACACTGAACAAGACATATGCGACCGAACTTCAACAAATGTGCCCCAAGAATGTGGACCCCAGGATCGCCATCAACATGGACCCCAACACA
CCCAAGACCTTTGATAATATGTACTTCAAGAATCTTCAACAAGGCAAGGGCCTCTTCACCTCCGACCAAGTCCTATATACCGACGGGAGGTCCAAGCCTGCTGTTGATAGATGGGCCTCT
AGCCCAGCTGATTTTCAAACGGCCTTTATCACCGCCATTACAAAATTGGGCAGGGTCAACGTCAAGACCGGAAGCGATGGGAATATTCGCCGGGATTGTTCAGCCTTTAATTGA

Retrieve as FASTA