Entry information : CsPrx[P]66 (orange1.1g037153m)
Entry ID 8923
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx[P]66 (orange1.1g037153m)
Name (synonym) CsPrx[P]66 (orange1.1g037153m)
Class Class III peroxidase     [Orthogroup: Prx037]*
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx[P]66
start..stop
S start..stop
CclPrx106 597 0 1..315 1..317
CppPrx06 342 2.47e-118 2..315 1..317
CclPrx48 342 3.07e-118 2..315 3..319
CsPrx07 342 3.18e-118 2..315 3..319
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8923' 'complement(join(128114..128509,128595..128738,128814..128878,128912..128968,128993..129014,129054..129314))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 129054..129314 259 N° 2 128993..129014 20 N° 3 128912..128968 55 N° 4 128814..128878 63
N° 5 128595..128738 142 N° 6 128114..128509 394  
complement(join(128114..128509,128595..128738,128814..128878,128912..128968,1289 93..129014,129054..129314))


exon

Literature and cross-references CsPrx[P]66 (orange1.1g037153m)
DNA ref. Phytozome 12:   scaffold00414 (129314..128114)
Protein sequence: CsPrx[P]66 (orange1.1g037153m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   313 (295)
PWM (Da):   %s   34198.61 (32317.6) Transmb domain:   %s   i7-29o
PI (pH):   %s   10.27 (10.39) Peptide Signal:   %s   cut: 19 range:19-313
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSYYLVLLLLIAASASLPANCNLSKHHYRSSCPQALSIVQAGV
KAAVKNETRTAASLLRLHFYDCFVNACNFKSLHTCSHLFVFA
MTRAVMDPSSVRNRSSYP*FKWRVQCACPGVVSWADILAIATRDSVVLGGPSWKVRLERRDSTTVSRTAANTSIRRPTSNLSALISNFMGSLIEAKSLFPMAGAHTIGLARCTTFREHIY
NGWNIGISFTESLRQICPASGNGSALASIYLQPVLIIYTTRIC*MKRVLHSGQELFNGNSANSLVKRYADDISVFVKDFPRATIKMGNISPLTGSAGQIRINCRKVN

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (Stops in frame).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACAAGTTACTACCTTGTCTTGCTTCTACTTATTGCTGCTAGTGCATCTCTTCCAGCCAACTGCAATCTCTCTAAGCACCACTACAGATCCTCATGCCCACAAGCATTATCTATT
GTTCAGGCAGGAGTTAAAGCTGCTGTTAAAAATGAAACCCGAACTGCGGCATCTTTACTCAGACTGCATTTCTACGATTGCTTTGTTAACGCATGCAACTTCAAGTCTTTACATACATGC
AGCCATTTGTTTGTGTTCGCT
TTAGGTATTTTTAACTAAATATATTTGATTTTGATGATGATATGACCAGGGCTGTGATGGATCGCTAATGTTGGATGACACAGCCAGCTCTTCATCAGT
GAGAAACCGCAGTTCCTATCCATAATTCAAGTGGAGGGTTCAATGCG
GTTGATGATATTAAAGCTAAAATGGAAAAAGAGCACATGCCCAGGTGTGGTGTCCTGGGCAGATATTCTCGCA
ATTGCTACTCGCGACTCAGTTGTTGAT
GTGAGCGCCAAATATTCCCTAGATGAAAAGCTGGTTGTTTCACCCTCATATGCTTCAATTTCTTGGCAATTGCAGTTTTAGGGGGTCCTTCAT
GGAAAGTTAGATTGGAAAGAAGAGATTCTACAACAGTAAGCAGGACAGCTGCAAACACTTCAATCCGTCGACCCACTTCTAATTTAAGTGCTCTCATATCAAACTTCATGGGGTCTCTCA
TTGAAGCA
CATGGTAGCTCTTGCTGGTAATTCAGCATTATTCAACTAATTGACAAAAGGATATGAAGAATCAATCTGCCTCTACCATAATTAAAAAAAAGCTTATTTCCGATGGCAGGGG
CACACACGATAGGCCTGGCAAGATGCACAACATTTCGAGAACACATTTACAATGGTTGGAATATTGGCATCTCCTTCACCGAATCATTGCGGCAAATATGCCCAGCAAGCGGAAATGGCA
GTGCTCTAGCAAGCATCTACCTTCAACCTGTTTTGATAATTTATACTACAAGAATCTGTTGAATGAAAAGAGTCCTTCATTCAGGTCAAGAGTTATTTAATGGTAATTCTGCCAATTCTC
TGGTGAAAAGATATGCTGATGACATCTCAGTGTTTGTCAAGGACTTTCCCAGAGCCACGATCAAGATGGGCAACATCAGTCCTCTTACCGGAAGTGCTGGACAGATCAGGATCAATTGCA
GAAAGGTCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACAAGTTACTACCTTGTCTTGCTTCTACTTATTGCTGCTAGTGCATCTCTTCCAGCCAACTGCAATCTCTCTAAGCACCACTACAGATCCTCATGCCCACAAGCATTATCTATT
GTTCAGGCAGGAGTTAAAGCTGCTGTTAAAAATGAAACCCGAACTGCGGCATCTTTACTCAGACTGCATTTCTACGATTGCTTTGTTAACGCATGCAACTTCAAGTCTTTACATACATGC
AGCCATTTGTTTGTGTTCGCT
ATGACCAGGGCTGTGATGGATCCTTCATCAGTGAGAAACCGCAGTTCCTATCCATAATTCAAGTGGAGGGTTCAATGCGCATGCCCAGGTGTGGTGTCC
TGGGCAGATATTCTCGCAATTGCTACTCGCGACTCAGTTGTTGAT
TTAGGGGGTCCTTCATGGAAAGTTAGATTGGAAAGAAGAGATTCTACAACAGTAAGCAGGACAGCTGCAAACACT
TCAATCCGTCGACCCACTTCTAATTTAAGTGCTCTCATATCAAACTTCATGGGGTCTCTCATTGAAGCA
AAAAGCTTATTTCCGATGGCAGGGGCACACACGATAGGCCTGGCAAGATGC
ACAACATTTCGAGAACACATTTACAATGGTTGGAATATTGGCATCTCCTTCACCGAATCATTGCGGCAAATATGCCCAGCAAGCGGAAATGGCAGTGCTCTAGCAAGCATCTACCTTCAA
CCTGTTTTGATAATTTATACTACAAGAATCTGTTGAATGAAAAGAGTCCTTCATTCAGGTCAAGAGTTATTTAATGGTAATTCTGCCAATTCTCTGGTGAAAAGATATGCTGATGACATC
TCAGTGTTTGTCAAGGACTTTCCCAGAGCCACGATCAAGATGGGCAACATCAGTCCTCTTACCGGAAGTGCTGGACAGATCAGGATCAATTGCAGAAAGGTCAAT

Retrieve as FASTA