Entry information : CsPrx[P]69 (orange1.1g038804m)
Entry ID 8926
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2012-01-03 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx[P]69 (orange1.1g038804m)
Name (synonym) CsPrx[P]69 (orange1.1g038804m)
Class Class III peroxidase     [Orthogroup: Prx002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx[P]69
start..stop
S start..stop
CclPrx[P]91 388 1e-137 11..296 1..256
CclPrx110 257 5e-85 4..295 9..328
CsPrx21 256 2e-84 4..295 9..328
EcamPrx43 241 1e-78 1..296 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 55510..55719 210 N° 2 55750..55770 21 N° 3 55817..55975 159 N° 4 56132..56467 336
join(55510..55719,55750..55770,55817..55975,56132..56467)


exon

Literature and cross-references CsPrx[P]69 (orange1.1g038804m)
DNA ref. Phytozome 12:   scaffold00633 (55510..56467)
Protein sequence: CsPrx[P]69 (orange1.1g038804m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   298 (276)
PWM (Da):   %s   32626.74 (30241.4) Transmb domain:   %s   i7-28o
PI (pH):   %s   10.35 (10.43) Peptide Signal:   %s   cut: 23 range:23-298
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGPIQVFIILVMVLLCATSVVS*LQIGFYRYSCGPAEFTVKDEVRKAFMKDKGVAAGLLRMHFRDCFVRACFPSFWLDGRASKASEATTNLPSPAFNAKQLTQSFAAKGLTQEDMMKDKGVAAGLLRMHFRDCFVRSGGLGYDVPAGRRDGRASKASEATTNLPSPAFNAKQLTQSFAAKGLTQEDMLIQFQWKPMCAVDLKRKCPKGNNNSNLVVPMNPASPSIKTTMSVTMLIFYATEGTLLQTKLCLLTQQHRIELKTIWGNKFVAAMVRMGPIGVVTGQAGEIRANCRVINSKNA*

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (Gaps and stop in frame).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCCAATACAAGTATTCATTATATTAGTAATGGTTTTGCTTTGCGCAACTAGTGTAGTGTCTTAGCTTCAAATTGGCTTTTATAGATATTCATGTGGCCCAGCCGAGTTTACTGTT
AAAGATGAGGTTAGAAAAGCGTTCATGAAGGATAAAGGAGTAGCTGCCGGCCTCTTGAGAATGCATTTTCGTGATTGCTTTGTTAGGGCA
AGTATATATACATACAAATTAAAATTATCT

TGTTTTCCCTCCTTTTGGTTA
ATTAAATTAATTATTTTGTTCTCTATTGATAATGTGAGATGTTTATGTGCAGAGTGGAGGACTTGGTTATGATGTTCCCGCAGGAAGAAGAGATGGGAG
AGCTTCAAAGGCCTCCGAGGCAACAACGAATTTACCTTCGCCAGCATTTAATGCGAAACAACTCACTCAAAGCTTTGCAGCTAAGGGCTTAACACAAGAAGATATG
GTTGTACTATCCCG
GTAATTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGAAGTAAATTGAGCATTTTAAAAACGATACACGTATTGCATGCACGAGCACACACCATAGGGCGCTCTC
AGTGCAGTTCCTTCACTGACAGCTTATACAATTTCAATGGAAACCCATGTGTGCAGTTGACTTGAAGAGGAAGTGTCCAAAAGGTAACAATAACTCAAACTTGGTGGTACCAATGAACCC
AGCTAGTCCAAGCATCAAGACAACCATGTCAGTCACCATGTTGATATTCTATGCAACCGAGGGCACTTTACTTCAGACCAAACTCTGCTTACTGACCCAGCAACATCGTATCGAATTAAA
AACAATATGGGGAAACAAATTTGTTGCTGCTATGGTCAGGATGGGCCCAATAGGTGTTGTAACTGGTCAAGCTGGAGAAATTCGAGCCAATTGTAGGGTTATCAACAGCAAGAACGCA

Retrieve as FASTA