Entry information : GmPrx105 (Glyma01g40870.1)
Entry ID 8935
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx105 (Glyma01g40870.1)
Name (synonym) GmPrx105 (Glyma01g40870.1)
Class Class III peroxidase    [Orthogroup: Prx046]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx105
start..stop
S start..stop
MtPrx90 584 0 16..331 16..331
PpePrx23 501 1e-180 5..332 3..333
PtPrx83 500 4e-180 19..332 27..338
VvPrx15 483 2e-173 1..331 1..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 52518370..52518582 213 N° 2 52518057..52518248 192 N° 3 52517804..52517969 166 N° 4 52517050..52517477 428
complement(join(52517050..52517477,52517804..52517969,52518057..52518248,5251837 0..52518582))


exon

Literature and cross-references GmPrx105 (Glyma01g40870.1)
DNA ref. Phytozome 12:   Gm01 (52518582..52517050)
Protein sequence: GmPrx105 (Glyma01g40870.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (310)
PWM (Da):   %s   37610.29 (34984.9)  
PI (pH):   %s   6.78 (6.60) Peptide Signal:   %s   cut: 23 range:23-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MERMRLLFIFISILFNATTLSGVELLVHNYYKEKCPLAEDIVRHNVEVAVLKNPRLAASLLRLHFHDCFVMGCDASVLLDNVEGMTSEKLAGPNLNSLRGFEVIDKIKYLLEEECPITVSCADILAMAARDAVELRGGPRWEVLLGRKDALESSFSGANILIPAPNSSLEVLIDNFKQQGLDIEDLVTLSGSHTIGRARCLSFRQRIYDAKEEYHYGYDHYKRYTSFRRILRSICPVEGRDNKFAPLDFQTPKRFDNHYFINILEGKGLLGSDNVLISHDLDGKITEQVWAYASNEKLFFASFAKSMIKMGNINVLTGNEGEIRRNCRFVNA*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from Phytozome (5' end is missing). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGCGCATGAGACTCTTATTCATCTTTATTTCTATTTTGTTCAATGCTACAACTCTGAGTGGTGTTGAACTTCTTGTTCATAACTACTACAAGGAGAAGTGTCCCTTAGCCGAAGAC
ATCGTTAGACATAACGTGGAAGTGGCAGTTTTAAAAAATCCTCGTTTGGCAGCCTCTCTACTTCGCTTACACTTCCACGATTGTTTTGTCATG
GTAACCATTTCCTTTTTCTGTTTCTTC
CTCTGCTTTGAGTTTTTCATTTTTCACGGCCCATGTTTCTCTGTTTGTTTAAACTTATTCATGATTCTTTTGTGGTTATTGAATTGAACATAAGGGATGCGATGCATCCGTGCTTTTGGA
CAACGTGGAGGGCATGACAAGTGAAAAGTTGGCTGGACCAAATCTGAACTCTTTACGTGGATTTGAGGTCATAGACAAGATAAAGTATTTGCTTGAAGAAGAATGTCCTATTACTGTTTC
ATGTGCTGACATCCTTGCCATGGCTGCACGTGATGCTGTTGAATTG
GTAAACACTGCTTTGTCACAGGGGTCAAATGAATGTAGTTATATTTTTATTTTGCTTTACAACAATTTCTATCA
TTTGTTTTTGAAGAGAGGAGGACCAAGATGGGAAGTCTTGCTTGGAAGGAAGGATGCTCTCGAGTCAAGTTTCAGTGGAGCTAACATATTAATTCCGGCTCCAAATTCATCTTTGGAGGT
TCTCATAGATAATTTTAAGCAACAAGGCCTCGACATAGAAGACTTGGTAACTCTATCTG
GTATATTTATTATTTTGACAAGATTTATATACAACTTTCTAAATTGCTGTTAGTACTATTT
TCTAATCAAAATTAGTGTCCCACGTCTTCATAAAAAAAAAAGTAGTGACCCACCTTTATGAATTATTGAAATGAAACTAATTTTAATTGAAAAATAACACAACCAAAATCCCAACTCTAA
TTGATGAATAACACAAACAATACCTATAAAAACTCTAATTTTGTCCTTATAATTTGTTCAAAGTTCAATCAAATGTTAATATTTTGGGGCTCTCACAAAGGAAGAAGAGATTAAGCACGT
AGAGTTCCTGCTTGACAAAATACAGGTAGCCATACTATAGGAAGAGCAAGATGTCTAAGCTTCAGGCAGAGGATATATGATGCAAAAGAGGAATATCACTATGGCTATGATCACTACAAA
CGATACACAAGTTTCAGGAGAATCCTGCGGTCCATATGCCCTGTTGAGGGAAGGGACAATAAATTTGCACCCTTGGATTTTCAAACCCCAAAAAGATTTGACAATCACTACTTCATAAAC
ATTCTTGAAGGGAAAGGCTTGTTAGGTTCTGACAATGTTCTTATCAGCCATGACTTAGATGGAAAGATTACAGAGCAGGTGTGGGCTTATGCCTCTAATGAAAAACTTTTCTTTGCTTCA
TTTGCTAAATCTATGATTAAGATGGGAAACATCAATGTTCTTACAGGAAATGAGGGGGAAATTAGGAGGAATTGTAGGTTTGTCAACGCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGCGCATGAGACTCTTATTCATCTTTATTTCTATTTTGTTCAATGCTACAACTCTGAGTGGTGTTGAACTTCTTGTTCATAACTACTACAAGGAGAAGTGTCCCTTAGCCGAAGAC
ATCGTTAGACATAACGTGGAAGTGGCAGTTTTAAAAAATCCTCGTTTGGCAGCCTCTCTACTTCGCTTACACTTCCACGATTGTTTTGTCATG
GGATGCGATGCATCCGTGCTTTTGGAC
AACGTGGAGGGCATGACAAGTGAAAAGTTGGCTGGACCAAATCTGAACTCTTTACGTGGATTTGAGGTCATAGACAAGATAAAGTATTTGCTTGAAGAAGAATGTCCTATTACTGTTTCA
TGTGCTGACATCCTTGCCATGGCTGCACGTGATGCTGTTGAATTG
AGAGGAGGACCAAGATGGGAAGTCTTGCTTGGAAGGAAGGATGCTCTCGAGTCAAGTTTCAGTGGAGCTAACATA
TTAATTCCGGCTCCAAATTCATCTTTGGAGGTTCTCATAGATAATTTTAAGCAACAAGGCCTCGACATAGAAGACTTGGTAACTCTATCTG
GTAGCCATACTATAGGAAGAGCAAGATGT
CTAAGCTTCAGGCAGAGGATATATGATGCAAAAGAGGAATATCACTATGGCTATGATCACTACAAACGATACACAAGTTTCAGGAGAATCCTGCGGTCCATATGCCCTGTTGAGGGAAGG
GACAATAAATTTGCACCCTTGGATTTTCAAACCCCAAAAAGATTTGACAATCACTACTTCATAAACATTCTTGAAGGGAAAGGCTTGTTAGGTTCTGACAATGTTCTTATCAGCCATGAC
TTAGATGGAAAGATTACAGAGCAGGTGTGGGCTTATGCCTCTAATGAAAAACTTTTCTTTGCTTCATTTGCTAAATCTATGATTAAGATGGGAAACATCAATGTTCTTACAGGAAATGAG
GGGGAAATTAGGAGGAATTGTAGGTTTGTCAACGCTTAG

Retrieve as FASTA