Entry information : GmPrx107 (Glyma02g04290.1)
Entry ID 8937
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-23 (Christophe Dunand)
Peroxidase information: GmPrx107 (Glyma02g04290.1)
Name (synonym) GmPrx107 (Glyma02g04290.1)
Class Class III peroxidase    [Orthogroup: Prx185]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx107
start..stop
S start..stop
GmPrx93 662 0 1..380 1..380
LjPrx43 431 2e-151 1..380 1..390
MtPrx83 420 3e-147 59..380 58..377
PpePrx40 256 2e-83 66..380 22..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3477217..3477579 363 N° 2 3477652..3478431 780  
join(3477217..3477579,3477652..3478431)


exon

Literature and cross-references GmPrx107 (Glyma02g04290.1)
DNA ref. Phytozome 12:   Gm02 (3477217..3478431)
Protein sequence: GmPrx107 (Glyma02g04290.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   381 (355)
PWM (Da):   %s   42198.56 (39252.9)  
PI (pH):   %s   6.51 (5.69) Peptide Signal:   %s   cut: 26 range:26-380
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKMTRIFLSTLSLCLLLLQLNLSKAQPGSPQKLPFTFHSLFPFFGRPEDANIPLKGPQDDLQNVPQQAADQKPQKLSPDFYIKTCPNAQKIVADALADIVKKNPGALGNLLRLQFHDCFVNGCDASILLDYSPSGDTVEKSSMVNGLLLKGADMIDDIKLKLEEQCPQTVSCADTLAFTANEVMTMAGLPPRKPLGGRRDALVSLSSAADADNLPLPDWTMDQMVKLFTKKGFNIEEMVILLGAHSIGMAHCDLFIQRAYNFQNTGKPDPTLTVEAVEEFKKACPNVNTPKYRNPPVNFDATPTVLDNLFYMEMVERNRTFLITDSHLLTDQRTLPLVQQFAHDPSLFPRRFPEVMLKLGSLNVLTGNEGEIRKICRSTN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAATGACAAGGATCTTCCTTAGCACCCTTTCCCTGTGCCTCTTGCTCCTCCAGCTGAATCTCTCCAAGGCCCAGCCTGGATCTCCCCAAAAACTTCCATTTACATTTCATTCTCTA
TTTCCATTTTTCGGCCGTCCAGAAGACGCCAACATACCACTAAAGGGTCCACAGGACGACCTTCAGAACGTGCCTCAACAGGCCGCCGACCAAAAACCTCAGAAACTCAGCCCAGATTTC
TACATAAAAACTTGCCCCAATGCCCAAAAAATCGTGGCCGATGCACTTGCAGACATCGTTAAGAAGAATCCCGGCGCTCTCGGAAACCTACTTCGCCTTCAATTCCATGACTGCTTCGTT
AAT
GTAAGCTTTTTCCTATTATCATATACTATTATTTCTTCTCTCTAAATTACACTCACACGTTTGCTTCAACAGGGATGCGATGCATCGATCTTGCTAGATTACTCGCCAAGCGGTGAC
ACCGTGGAGAAAAGTTCAATGGTGAATGGTCTACTCCTGAAAGGAGCTGATATGATCGATGACATAAAGTTGAAGCTGGAGGAGCAGTGTCCTCAAACTGTGTCATGTGCTGACACATTG
GCATTTACAGCCAACGAGGTAATGACCATGGCGGGTTTGCCCCCTCGGAAACCCCTCGGTGGCCGTAGAGACGCGCTGGTTTCCCTTTCCAGTGCGGCAGACGCCGACAACCTCCCTTTG
CCAGACTGGACCATGGATCAAATGGTAAAACTCTTCACCAAAAAGGGCTTCAACATCGAAGAAATGGTGATCCTACTCGGTGCACATTCTATCGGCATGGCTCATTGTGACTTGTTCATC
CAAAGGGCATACAACTTCCAAAACACAGGGAAACCCGACCCTACCCTTACCGTCGAAGCGGTTGAGGAATTCAAAAAGGCATGCCCCAATGTTAATACACCTAAGTACAGGAACCCCCCT
GTCAACTTTGATGCAACACCAACTGTGCTTGATAACCTCTTCTACATGGAAATGGTCGAGAGAAACAGAACTTTTCTCATTACGGATTCCCATTTGTTGACAGATCAGAGGACTTTGCCA
CTTGTGCAACAGTTTGCACATGACCCTAGCTTGTTCCCCAGGAGATTTCCTGAGGTCATGCTTAAGCTCGGTTCTTTGAATGTCCTCACAGGGAATGAAGGCGAGATCAGGAAGATTTGT
AGGTCCACCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAATGACAAGGATCTTCCTTAGCACCCTTTCCCTGTGCCTCTTGCTCCTCCAGCTGAATCTCTCCAAGGCCCAGCCTGGATCTCCCCAAAAACTTCCATTTACATTTCATTCTCTA
TTTCCATTTTTCGGCCGTCCAGAAGACGCCAACATACCACTAAAGGGTCCACAGGACGACCTTCAGAACGTGCCTCAACAGGCCGCCGACCAAAAACCTCAGAAACTCAGCCCAGATTTC
TACATAAAAACTTGCCCCAATGCCCAAAAAATCGTGGCCGATGCACTTGCAGACATCGTTAAGAAGAATCCCGGCGCTCTCGGAAACCTACTTCGCCTTCAATTCCATGACTGCTTCGTT
AAT
GGATGCGATGCATCGATCTTGCTAGATTACTCGCCAAGCGGTGACACCGTGGAGAAAAGTTCAATGGTGAATGGTCTACTCCTGAAAGGAGCTGATATGATCGATGACATAAAGTTG
AAGCTGGAGGAGCAGTGTCCTCAAACTGTGTCATGTGCTGACACATTGGCATTTACAGCCAACGAGGTAATGACCATGGCGGGTTTGCCCCCTCGGAAACCCCTCGGTGGCCGTAGAGAC
GCGCTGGTTTCCCTTTCCAGTGCGGCAGACGCCGACAACCTCCCTTTGCCAGACTGGACCATGGATCAAATGGTAAAACTCTTCACCAAAAAGGGCTTCAACATCGAAGAAATGGTGATC
CTACTCGGTGCACATTCTATCGGCATGGCTCATTGTGACTTGTTCATCCAAAGGGCATACAACTTCCAAAACACAGGGAAACCCGACCCTACCCTTACCGTCGAAGCGGTTGAGGAATTC
AAAAAGGCATGCCCCAATGTTAATACACCTAAGTACAGGAACCCCCCTGTCAACTTTGATGCAACACCAACTGTGCTTGATAACCTCTTCTACATGGAAATGGTCGAGAGAAACAGAACT
TTTCTCATTACGGATTCCCATTTGTTGACAGATCAGAGGACTTTGCCACTTGTGCAACAGTTTGCACATGACCCTAGCTTGTTCCCCAGGAGATTTCCTGAGGTCATGCTTAAGCTCGGT
TCTTTGAATGTCCTCACAGGGAATGAAGGCGAGATCAGGAAGATTTGTAGGTCCACCAATTAA

Retrieve as FASTA