Entry information : GmPrx[P]109 (Glyma02g05940.1)
Entry ID 8938
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2015-08-11 (Christophe Dunand)
Peroxidase information: GmPrx[P]109 (Glyma02g05940.1)
Name (synonym) GmPrx[P]109 (Glyma02g05940.1)
Class Class III peroxidase     [Orthogroup: Prx004]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]109
start..stop
S start..stop
GmPrx274 289 2.82e-99 1..190 1..189
GmPrx[P]99 241 1.72e-80 15..190 1..175
GmPrx27 238 6.99e-79 1..190 1..195
GrPrx04 236 3.32e-78 1..190 1..197
Gene structure Fichier Exons


exon

Literature and cross-references GmPrx[P]109 (Glyma02g05940.1)
DNA ref. Phytozome 12:   Gm02 (4769332..4768028)
Protein sequence: GmPrx[P]109 (Glyma02g05940.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   202 (180)
PWM (Da):   %s   21684.98 (19332.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   4.65 (4.65) Peptide Signal:   %s   cut: 23 range:23-202
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MANSMSFLLLLSLLAFAPLCLCNPNLQFYNNSCPQAQLIVKSILTSYFVFHPGYAAQILSLHFHDYFVQGCDGSVLLDSSESIVNEKESNNDRDSLRGFIVIDAIKLALLxRECPSTVSC
ADILTIAASDSVVLTGGPSWLVSLGRRDSRDASISGSNNNIPASNCTFQILQTKFEQQGLNITDLVALSGILLKLCLCLESF

Retrieve as FASTA  
Remarks Pseudogene sequence from genomic. Incorrect prediction from Phytozome (Exon 4 is missing).
DNA
Send to BLAST
CDS
Send to BLAST