Entry information : SbPrx93 (Sobic.006G135800.1 [2.1] / Sb06g021550 [1.4])
Entry ID 894
Creation 2006-08-08 (Christophe Dunand)
Last sequence changes 2011-01-18 (Toky Ramarohetra (Scipio))
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx93 (Sobic.006G135800.1 [2.1] / Sb06g021550 [1.4])
Name (synonym) SbPrx93 (Sobic.006G135800.1 [2.1] / Sb06g021550 [1.4])
Class Class III peroxidase    [Orthogroup: Prx030]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Seedlings
Inducers Ethylene treatment
Heat shock stress
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx93
start..stop
S start..stop
SiPrx57 602 0 42..376 22..371
ZmPrx95 563 0 8..376 120..472
BdiPrx130 515 0 76..376 199..496
OsPrx5556 502 1e-177 75..376 206..508
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 50789222..50789584 363 N° 2 50788270..50788449 180 N° 3 50787403..50787568 166 N° 4 50786854..50787275 422
complement(join(50786854..50787275,50787403..50787568,50788270..50788449,5078922 2..50789584))


exon

Literature and cross-references SbPrx93 (Sobic.006G135800.1 [2.1] / Sb06g021550 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_6 (50789584..50786854)
EST ref. GenBank:   CD204129 [5' end]
Cluster/Prediction ref. PlantGDB:   SbGSStuc11-12-04.5095.1
Protein sequence: SbPrx93 (Sobic.006G135800.1 [2.1] / Sb06g021550 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   376
PWM (Da):   %s   38397.35  
PI (pH):   %s   7.22
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPAPKPSPSVAPAPRPSSPPPATPAPPAPPRTAPKPSPPLAPRQSPTPAASPPPPAPPQPPSKSTPTMSSTLGQLSPSFYAQSCPGVELAVRDVVRSASTLDPSIPGKLLRLVFHDCFVEGCDASVLIQGNGTERTDPANLSLGGFNVIDAAKRLLEVVCPATVSCSDIVVLAARDAVVFTGGPAVPVALGRRDGLVSLASNVRRNIIDTGFSVDAMAASFTAKGLTLDDLVTLSGGHTIGSAHCNTFRERFQVANGSMTPIDGSMNADYANELIQACAAANGAASAATAVDCDSGSASVFDNRYFANLLDGRGLLRTDAVLVQNATTKAKVAEFAQSQDGFFASWASSYARLTGLGVKTGADGEIRRTCSSVNG

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 2 ESTs . Transcript 5' more long in phytozome version.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCGGCTCCTAAACCATCCCCATCTGTCGCGCCGGCGCCAAGGCCATCGTCTCCTCCACCTGCCACACCGGCACCACCAGCTCCTCCTCGGACGGCTCCGAAGCCGTCCCCGCCC
TTGGCTCCGAGACAGTCTCCAACACCGGCGGCTTCACCGCCACCACCTGCTCCCCCGCAGCCTCCGTCGAAGTCCACGCCGACGATGTCCTCCACACTGGGCCAGCTCTCGCCCAGCTTC
TACGCGCAGTCCTGCCCGGGCGTTGAGCTGGCGGTGAGGGATGTCGTTAGGTCGGCATCCACCCTGGACCCCTCCATTCCCGGCAAGCTTCTTAGGCTGGTCTTCCATGACTGCTTCGTC
GAG
GTATGGAATGCACTGTCTGAATCCTTGCATTTGGTTGTTAAATAAACACTCCATCGTTGCAGACTGAGGACTTTTTTTTTGTTGTGCTCCCCAACAATTAGTGAAATGGATGTGCCT
GATCTAGATGATCATGCAGAGATATTTTCGTGATTAGCTTTTTTGCATGCAAAAAGAAAGGATCTAGTTTACATTCAGGGGCTGCCAGGTGCAATTCCTATCTCATGTTGCTTTGCTCAA
CGATTTTTTACCCCCGTTGTTCAGAGTGCTGAGCAGAAAATATGCAATAGTTGTGCAGACCCAAAGAAATGAACAAGTACAAATTGTAGCAGCAAGTTAACCGTTACCACTTTACCAGTT
ACCTGGAACAAGACCAAGAAAACTGTTTTGAATTGCATCCTCTGATAACGCCACTGCTCAAATCTTTGCATTTATCTATCCTGCTTCCATTTGTCTTGATCCTAAATTCCTAATCACGTG
CATGGATTAGTTTTGGATGTGCCAACATACTCAAAAGTGCGAGAATGGTAGCCTATCTGGTAGACTGGTAACCAAACACAAACAGTTTAGTCAGACCAAGATCTCTTCAAACATCATTAA
TGCCTAGTTGAATACTGGGTACCAAACATCAGTGTAGTCTTTGAAAGCTTTGCATGTGTGTGACTGAAGGCAGCAGCTTATCATATTGCACCCCTGCACACTCTTTATGAAACTTCAGCG
TCCACACTGACATAATACGATTCAGGTTAATGAGTGTTTGTTTTCTTGATCTTAGGGATGCGATGCATCGGTGTTGATACAAGGTAACGGTACTGAGAGGACCGATCCTGCAAATCTCTC
ACTTGGTGGGTTCAATGTCATCGATGCAGCAAAGAGGTTGCTAGAAGTCGTGTGCCCTGCGACTGTTTCTTGCAGTGACATTGTCGTCCTCGCTGCAAGGGATGCTGTTGTGTTT
GTAAG
TATGACAGTCCAATCAGCTCAAACCTCTTCAATGTACAGTTGCTGCAGTTTTGCCTTAGCTTTGCCAAAATTCACCCAAACTGTGAATGCTCCAATAGTTACCTTGGTGCTTAACTTTAA
ACATCTCGTAGAAACAATACGTAGTGCCAGTCTTAGAGCACTCACAATGCAGACTCTATTATGGAGTCTAAAGTTATTTATTACCTCGAATAATGAGGATTTAGAGTCTAAATAAGACTT
GGAGTCTTATTTTTTCTACCTCTTTCTTCAATAAATATGCTGCCACATCAGCAAAATACCATAAATAATATGTAACTAATTGTCTTGGACTCTATGATAGAGTCTTGCATTGTGAGTGCC
CTTAACTACTTACCTGAACATGGGCCAACACAGAATCTCTCGTTAATAAATGTTGAAGGGATTAGATCTCTACGCAATCAATGAATTGATAGTTTCTGGTCCCGTATACTGTATGATAAG
TATGCTGTGACCAAACATCTGCAAGAAGATACAGCTTGCATACTACTCCTAGGTTAGTCCAAATACTACTCTGTGATACAGGTCCCAAAATCAACATAATTCTGTTTCCATGATGTCTCA
TGTCTGCCATCTTATGTTTGGGGCAAAGCCGCAGTATGTCCATTTAACAATCCACTAACTGAGATTCTTGTGTACGAACTTTTGTTCCAAAACAAGACCGGAGGACCGGCGGTGCCTGTG
GCCCTGGGAAGACGAGACGGCCTCGTCTCATTGGCATCCAATGTCCGAAGAAACATCATCGACACGGGTTTCTCCGTCGACGCCATGGCGGCCAGCTTCACCGCCAAGGGGCTCACCCTG
GACGACCTCGTCACCCTCTCAG
GCGTGCAGACGAAAAACTTTGGCCCCCTCCTTTTTTTTTTTTTTTTGGTAATGCGAAACTGGACGCATCTCACCGACGTCGTCTTGCGCGCGTGCTGT
GCTGTGCTGCGCTGTGCTGTGCTGTGCAGGCGGCCACACCATCGGGTCGGCGCACTGCAACACGTTCCGGGAGCGGTTCCAGGTGGCGAACGGGAGCATGACGCCCATCGACGGGTCGAT
GAACGCCGACTACGCGAACGAGCTGATCCAGGCGTGCGCGGCGGCGAACGGCGCCGCGTCGGCGGCCACGGCCGTGGACTGCGACTCCGGGTCGGCGTCCGTGTTCGACAACCGCTACTT
CGCGAACCTGCTGGACGGGCGGGGCCTGCTGCGCACGGACGCCGTGCTGGTGCAGAACGCCACGACGAAGGCCAAGGTGGCGGAGTTCGCGCAGAGCCAGGACGGCTTCTTCGCGAGCTG
GGCCAGCTCGTACGCCAGGCTCACCGGCCTCGGCGTGAAGACCGGCGCCGACGGCGAGATCCGGCGGACCTGCTCCAGCGTCAATGGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCGGCTCCTAAACCATCCCCATCTGTCGCGCCGGCGCCAAGGCCATCGTCTCCTCCACCTGCCACACCGGCACCACCAGCTCCTCCTCGGACGGCTCCGAAGCCGTCCCCGCCC
TTGGCTCCGAGACAGTCTCCAACACCGGCGGCTTCACCGCCACCACCTGCTCCCCCGCAGCCTCCGTCGAAGTCCACGCCGACGATGTCCTCCACACTGGGCCAGCTCTCGCCCAGCTTC
TACGCGCAGTCCTGCCCGGGCGTTGAGCTGGCGGTGAGGGATGTCGTTAGGTCGGCATCCACCCTGGACCCCTCCATTCCCGGCAAGCTTCTTAGGCTGGTCTTCCATGACTGCTTCGTC
GAG
GGATGCGATGCATCGGTGTTGATACAAGGTAACGGTACTGAGAGGACCGATCCTGCAAATCTCTCACTTGGTGGGTTCAATGTCATCGATGCAGCAAAGAGGTTGCTAGAAGTCGTG
TGCCCTGCGACTGTTTCTTGCAGTGACATTGTCGTCCTCGCTGCAAGGGATGCTGTTGTGTTT
ACCGGAGGACCGGCGGTGCCTGTGGCCCTGGGAAGACGAGACGGCCTCGTCTCATTG
GCATCCAATGTCCGAAGAAACATCATCGACACGGGTTTCTCCGTCGACGCCATGGCGGCCAGCTTCACCGCCAAGGGGCTCACCCTGGACGACCTCGTCACCCTCTCAG
GCGGCCACACC
ATCGGGTCGGCGCACTGCAACACGTTCCGGGAGCGGTTCCAGGTGGCGAACGGGAGCATGACGCCCATCGACGGGTCGATGAACGCCGACTACGCGAACGAGCTGATCCAGGCGTGCGCG
GCGGCGAACGGCGCCGCGTCGGCGGCCACGGCCGTGGACTGCGACTCCGGGTCGGCGTCCGTGTTCGACAACCGCTACTTCGCGAACCTGCTGGACGGGCGGGGCCTGCTGCGCACGGAC
GCCGTGCTGGTGCAGAACGCCACGACGAAGGCCAAGGTGGCGGAGTTCGCGCAGAGCCAGGACGGCTTCTTCGCGAGCTGGGCCAGCTCGTACGCCAGGCTCACCGGCCTCGGCGTGAAG
ACCGGCGCCGACGGCGAGATCCGGCGGACCTGCTCCAGCGTCAATGGCTGA

Retrieve as FASTA