Entry information : GmPrx121 (Glyma02g40040.1)
Entry ID 8942
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-23 (Christophe Dunand)
Peroxidase information: GmPrx121 (Glyma02g40040.1)
Name (synonym) GmPrx121 (Glyma02g40040.1)
Class Class III peroxidase    [Orthogroup: Prx186]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx121
start..stop
S start..stop
GmPrx50 589 0 23..324 23..324
PvPrx03 566 0 1..324 1..324
MtPrx29 493 1e-177 1..324 1..326
PtPrx41 438 7e-156 4..324 5..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 45238680..45238904 225 N° 2 45240252..45240434 183 N° 3 45241012..45241180 169 N° 4 45242272..45242669 398
join(45238680..45238904,45240252..45240434,45241012..45241180,45242272..45242669 )


exon

Literature and cross-references GmPrx121 (Glyma02g40040.1)
DNA ref. Phytozome 12:   Gm02 (45238680..45242669)
Protein sequence: GmPrx121 (Glyma02g40040.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (296)
PWM (Da):   %s   34921.72 (32064.3)  
PI (pH):   %s   9.51 (9.51) Peptide Signal:   %s   cut: 29 range:29-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALSSSSSSTSIFALALFTLLLIGSSSAQLSENFYDSKCPKVFYAVKSVLQSALAKEPRQGASIVRLFFHDCFVNGCDGSVLLDGPSSEKTAPPNNNSLRGYEVIDAIKSKVETVCPGVVSCADIVTIAARDSVAILGGPYWKVKLGRRDSTTGFFNLASSGVLPGPGSSLSDLIKRFDDQGLSTKDMVALSGAHTIGKARCASYRGRIYNENNIDSLFAKARQKNCPKGSNGTPKDNNVAPLDFKTPNHFDNEYFKNLINKKGLLHSDQELFNGGSTDSLVRAYSNNQKAFEADFVTAMIKMGNIKPLTGSNGQIRKQCRRPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACTTTCTTCTTCATCATCTTCAACATCCATATTTGCTTTAGCTTTGTTCACTCTTTTGCTTATAGGAAGTTCTTCAGCTCAACTCTCTGAGAACTTCTATGATAGTAAATGTCCC
AAGGTTTTCTATGCCGTAAAATCCGTTCTTCAATCTGCTTTGGCTAAAGAACCTCGCCAGGGAGCATCTATCGTTCGCCTCTTCTTTCATGACTGCTTTGTCAAT
GTAAATTACTACTCC
TAATCTAAGCTCTTTTGAGTTTTTATTTTTCTTATATATACTATAATACTATATATTAATCTATGGTCTATCAAGGGTAATACTTAACTACTTTTAGCATCAATGAAACAAAACTTATTT
AATTCATATGGTTGCAACAAAATTTTCAAAGATTTCAAATCGTTCATGTTTTCCTTCATTAAGAACGTAATGGGTTGTGTGTGGATAATCGTAGTCGTAATACTAAAATACAAGTATTTA
ATAGTGTAATACTATGTTCTTTTTAGTCGCTATTGGCCATTTATACGTATTTTTCTTTCTTTCTAAGTTTAATCGCTTTCAACAAGTCTTATTCGATGATGTGACATCACCAATAATATG
ACACGTTTGAAGCATAAAAAAAATGAAGTGAAAATGTTCTTATCTAGATGTTTTCATGATTAATTACGTACACCACTTCTTTTTAAAACATAGGTTTTTGGTTTATCCGCCCACAAGCCA
TAGGTCCGAATCGATCTGATAGAATAAATCAGTATATTTAAATATTATTAGTCGAATTTGAATCATAATACTCAATTTATTTATGACTAAAATAAAATATTACAATCTTTCATAAATAAT
TCATACATCTATGTTTCTTTTTCATCAATTTCCTTTGTACAGTACATTAATTTATCACAATACACATTAATTAGAGAGTGCAAATTAACATTTTATTCACATGGTAGAATAACATATTTC
CAACAAAAAGTAAAAGATAATCAATTATAAAATATTATCCAGGTACATGTAAGAATGTCTCAATGAGTCATGAGACGAATTGTGTTAGGTTGACTTCTCGGGTTAAAATTTTTTTTTTGG
TTATTTTGATCAATTTAGTTAAGTATTTTAGTTAGATGTAATATTTTGTGGACTATTACGAATTTTATGTTATTTTATTACTTTGTTTTATATTTATTTAAAACATGATTATAGTTTTTC
AATATCATTTGTGCTAAGATAATTTAATGAGATGAAGCTTTTTATAGTGAAGTTCAACCCGCAACCTAGTTTTCTTGATTGTGTTGGGTTAAAAATTTTAATCCAATTAATCTGTGGTAC
CCATCCCCGGTTGGAGTTATGTTAGCCTATTTTAATTAACATCCTACGTACATGCCAACTTTTTATACAGTATTCAACTATGGTGTTCTTTAAATATGCATGTTGTTCTTTTGGCATAGA
ATGCTTCCTTAATTCTAAAGTAAACTTTCACATATCAATAATCCAATTCCGGCAAAGTTAGTCACTGTTTTATAAAGTGCTTACAACTAATTATTGCTAATTGTGTGTTGCTGCTTAATT
GGAAATTAATAGGGTTGTGATGGATCAGTACTACTTGATGGCCCTTCCTCAGAGAAGACTGCACCTCCCAACAATAACTCTTTGAGAGGTTATGAAGTCATTGATGCCATCAAGTCTAAG
GTCGAGACAGTATGCCCCGGAGTGGTGTCATGTGCTGATATTGTAACCATTGCTGCTCGTGACTCTGTTGCAATC
GTGAGAGTTCAAAACTAATATATGCTATGCNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTAAACGTACTAAGAAAACTGGTTAACAATATCCTTAAAAAAATGTATATGACTTT
TTTAAGTGATCTTATAAAGTTAACTTTTGATATTGAACATTTATGCATAATTTATTCACCTTATTTGTAGTTTTTATTTCTCACAATAACTATGTCACACACATGAGAAATGTTATGAAT
AGAAACTCCAAAGTTATTGAACATCTACAGAAAAGAGACTTGATAGAAAAAATTAATGGATGTCAATGGAGTATATCATTACTCCACACACACAAATACATACATATATATATGTGGTTC
TTACATATTTATTTATCAATTATTATGATTTATAAAATTTCATGGTATGCAGCTTGGAGGGCCATATTGGAAGGTTAAACTTGGTAGAAGGGATTCCACGACTGGATTTTTCAACCTTGC
TAGCAGTGGTGTGCTCCCAGGACCTGGTTCTTCCCTCAGCGACCTTATCAAAAGATTTGATGATCAAGGGCTCTCTACCAAGGACATGGTTGCATTATCTG
GTATATGTCCTTTTCTCTC
TTCTTTCTAGTTTGGCCCCTCTCTCTTTCTCATCTCTCTAGTCTCTTGTATGTATGTGTGACGCAATCTGTATTATTACTAAATTATTGGGTACGTAGATATATTTTCAAGATGACTTTA
TAGTTTATACAACCGTATGGCTTTCCATCCAAAGAAATTTTGTTTATTTATACAGTATTTTCATAAGATTGATAGGAGAAGAAGTGAGAAAAAATGTGAAATAAAATAATAGATGAGTAC
TGTGACAAAAAAAAAGAAAAGAAATTTCATTATATAATGCAGTATCTCACTATCTCTTTACTTAATAATTACGTGTGGTGGATATGTGGACCTGGATGTGACATTTAAACTACTACGTAC
ATGAATGCCATGCTCTTTCTCTAGGCTAAAAGCCATGTGGCTTCTAAACAATAAACAGAGAAGAGTCAAGTTAAAGGAAAAGCATGTTTAACTAACTGGGAAAAGATATATACGGCATTA
TTGATTGGTAATGCTTAAATAATGTTTCTACGGCTAAAAAAGAAAAACACACCATCCATTGACATATCATTTTCAGTTAGCATTATTCTGCCTCAAGAGTCTTTCGTTATTTGTATATTA
TATTTATGTATGTTAAATACATATTCAATTTATACACTAGATTAATGAACGTACTTATTATTTGACAAGTAAATTATATGTGGTGTGAAATTCAAATGTAAAAGTATGAATTAATTATCA
ATTTCATTAGTGCATATCAATTCTATAACACACCATGTATATATACAAAAGAACTATTCAACTGTAACCTCATGTTTCAATATTTGTTTGTACTGTTAAACACTTTACATGGTACGTAGC
TGATGACTTTATCTAGTGGGATCTCAAACTAAACAATATTTTAGAAATTTTGGGTTTTAACCATGTTGAATGACATCATTGATTCATTTAGTCAAATCACGTTCATCATCCAATGCGGGA
TAAAGCTTTGTAGTTGTTGACTTGTTTGTCAAACACTTCACATGTCACAAGTGTTACTATTCAGACGTACTACGCTTGTTTATTTGATATTTTTCTTTGTGATATATTTCAGGAGCACAC
ACAATTGGAAAGGCAAGGTGTGCAAGTTATAGAGGTCGCATATACAATGAAAACAACATTGACAGTTTATTTGCCAAGGCAAGGCAAAAGAACTGTCCAAAAGGTAGCAATGGAACACCA
AAGGACAACAATGTAGCACCACTAGACTTCAAAACTCCTAACCATTTTGACAACGAGTACTTCAAGAACCTCATCAACAAAAAGGGTCTCCTTCATTCTGATCAAGAGCTCTTCAATGGA
GGATCCACAGATTCACTAGTGAGAGCTTACAGCAACAATCAAAAGGCCTTTGAGGCTGACTTTGTCACTGCAATGATTAAGATGGGAAACATCAAACCCTTAACTGGGTCAAATGGGCAG
ATAAGGAAGCAATGTAGGAGGCCCAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACTTTCTTCTTCATCATCTTCAACATCCATATTTGCTTTAGCTTTGTTCACTCTTTTGCTTATAGGAAGTTCTTCAGCTCAACTCTCTGAGAACTTCTATGATAGTAAATGTCCC
AAGGTTTTCTATGCCGTAAAATCCGTTCTTCAATCTGCTTTGGCTAAAGAACCTCGCCAGGGAGCATCTATCGTTCGCCTCTTCTTTCATGACTGCTTTGTCAAT
GGTTGTGATGGATCA
GTACTACTTGATGGCCCTTCCTCAGAGAAGACTGCACCTCCCAACAATAACTCTTTGAGAGGTTATGAAGTCATTGATGCCATCAAGTCTAAGGTCGAGACAGTATGCCCCGGAGTGGTG
TCATGTGCTGATATTGTAACCATTGCTGCTCGTGACTCTGTTGCAATC
CTTGGAGGGCCATATTGGAAGGTTAAACTTGGTAGAAGGGATTCCACGACTGGATTTTTCAACCTTGCTAGC
AGTGGTGTGCTCCCAGGACCTGGTTCTTCCCTCAGCGACCTTATCAAAAGATTTGATGATCAAGGGCTCTCTACCAAGGACATGGTTGCATTATCTG
GAGCACACACAATTGGAAAGGCA
AGGTGTGCAAGTTATAGAGGTCGCATATACAATGAAAACAACATTGACAGTTTATTTGCCAAGGCAAGGCAAAAGAACTGTCCAAAAGGTAGCAATGGAACACCAAAGGACAACAATGTA
GCACCACTAGACTTCAAAACTCCTAACCATTTTGACAACGAGTACTTCAAGAACCTCATCAACAAAAAGGGTCTCCTTCATTCTGATCAAGAGCTCTTCAATGGAGGATCCACAGATTCA
CTAGTGAGAGCTTACAGCAACAATCAAAAGGCCTTTGAGGCTGACTTTGTCACTGCAATGATTAAGATGGGAAACATCAAACCCTTAACTGGGTCAAATGGGCAGATAAGGAAGCAATGT
AGGAGGCCCAATTAG

Retrieve as FASTA