Entry information : GmPrx123 (Glyma02g42750.1)
Entry ID 8943
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-12-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-11-28 (Qiang Li)
Peroxidase information: GmPrx123 (Glyma02g42750.1)
Name (synonym) GmPrx123 (Glyma02g42750.1)
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx123
start..stop
S start..stop
GmPrx22 512 0 1..317 1..314
LjPrx15 447 8e-160 1..317 1..316
MtPrx34 428 2e-152 1..317 1..318
MtPrx37 419 1e-148 1..317 1..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 47738683..47738889 207 N° 2 47739165..47739353 189 N° 3 47739733..47739987 255 N° 4 47741350..47741642 293
join(47738683..47738889,47739165..47739353,47739733..47739987,47741350..47741642 )


exon

Literature and cross-references GmPrx123 (Glyma02g42750.1)
DNA ref. Phytozome 12:   Gm02 (47738683..47741642)
Protein sequence: GmPrx123 (Glyma02g42750.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (299)
PWM (Da):   %s   34287.63 (32360.6)  
PI (pH):   %s   8.26 (8.27) Peptide Signal:   %s   cut: 19 range:19-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASYYFLLLLVLVGATTAASEEELCTDFYSCTCPNLLPIVKKGVAKAIQKEPRMGASLLRLHFHHFFVNGCDAPILLDDTSNFVGEQTAEANNQSARGFNVINDIKANVEKECPRVVSCADILALAARDSVVHLQLGGPTWEVGLGRRASTTACRSDANNNIPGPFLSLSALINNFANQDLSVTDLVALSGVIIYLRCLKSVKIYASQQKIIPHFNKSLQSKCPRSGNDKILEPLDHQTPIHFDxxIFQNLVSKKALLHSDQELFNSSSTDNLVRKYAANYxAAFFEDFAKGMVKMSNIKPLTGSKGQIRINCGKIN

Retrieve as FASTA  
Remarks Complete sequence from genomic. No EST. Incorrect prediction from Phytozome (=>3' end contains stop in frame and 2 frame shift).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTACTACTTCCTCCTCTTGCTAGTTCTCGTTGGTGCAACTACAGCAGCTTCTGAGGAAGAGCTATGCACAGACTTTTACTCCTGCACCTGCCCAAACTTGTTGCCTATAGTG
AAGAAAGGAGTGGCCAAAGCCATTCAGAAAGAACCACGCATGGGGGCTTCCTTACTCCGATTGCATTTCCATCACTTCTTTGTAAAC
GTGAGTATATAATAATTAATAATGTAGTATAAT
ATATATATGTGCATTTATGTTTACTTCATTTAACCTTTTGTATAGGCTGCAAGGTGCAAGAAATTAGGTAGTCTGACTCATTATGGTCCAAATAATCTTATAATGACACGTAATTAAGTG
TCAAATGTTGTTAATTCTTGTTGTAAATTGAAAATTTTAAATATATCTCACATAAAGATTGACTGAAATTATCTAATAATTAGCTTGTTCCAAGTTGCTTTCATAAGATAGTGATATTTC
AGGGTTGTGATGCACCAATACTGTTGGATGATACAAGCAACTTCGTTGGAGAGCAAACAGCAGAAGCTAACAATCAATCAGCTAGAGGGTTCAACGTGATTAATGATATTAAGGCCAATG
TGGAGAAAGAATGCCCCAGAGTGGTGTCATGTGCTGATATTCTTGCTCTGGCAGCTCGAGATTCTGTAGTT
TGTGTAATATAGATACTCCTTTCGTTTTTTTTTTTAATTATGGGATTTT
GGAGAAATTTTATTTCTATTTACATGTTATTTATAAAATTTAAGATCACATTAAATGTTTTTTATCCATTAATTTTTTTTATCTTTAATTAATGTAGCCATGTATTTATTATGAAATAGA
AAGAAAAAGGAATTAAATAGGAAACTCCACACCTATTTTGTTATAGTTGAAAAATTATTATATTTTTTTATTTCAAGAAAATAACTTTAAAAAACAGATAAAAAGCAACTGAAGTAGTAA
TATTCTGTGATTCTATTTCTATCCCAGTCAAAGTTATCAATTATTATGGCCCTTGAATTAGTAGCACTTACTATATCTTTTTGTGTAAAACATTTGCAGTTAGGAGGACCTACTTGGGAA
GTGGGGTTGGGGAGAAGAGCTTCTACTACAGCATGTAGAAGTGATGCTAATAACAACATTCCCGGGCCTTTCCTCAGTCTATCTGCTCTCATAAACAATTTTGCTAATCAAGACCTCTCA
GTTACAGACTTGGTGGCTCTTTCAGGTGTTATAATATATTTGAGATGTCTTAAGTCAGTTAAAATATATGCCTCCCAACAAAAAATAATCCCTCATTTTAATAAA
AGTTAAAATAAATGT
TTTTTAATATTTTTTATCCATAAAAATAAAAAACAGAAAATTTACAACAACTTACTTACGCACCGACCACCTTACTTTTTAATACATCTGGGTTCCAAATTAAAGTTGTGGTTTTATATA
TGTGGAATGATTGTGATGGCATGTGGAGTTTCTTGCATTAGTAATTCATTTTACATAATAGTAGTAGTATCTATTTAAATAGAATTTGCAAGAGATGAACTCATAAAAAACTGAGGAAAT
TGTTGTTCTTCCCTTTCATTTTAACTAAAACGAATAATGTGATATTCGACCAAAAAAAATTATTAGATGTAAAGAAACTAATTTTGTGATTCTGCCTTTTCAGAGCTTTTTCCATAAACT
AATTCTTTCCACTTTTAAGAAAAATACTAAATATTTTTTACTTTTCATTTTTTAAAACTAGCATAATTATTATAATCTTTTGAACATATGCATAATTAAAAACACACTTTTTCCTAACGA
AATCAAACAAAAAGGTCCCCAATTTATTTTTTTCATGCAGTCCAACAAAAACTCATTCTTTACTCATCTGCTATCCATTGAGGTATGAAATTAGAACCAATTTATTATTTATTACTTTTC
TTATTATTCGGTTTACTTCTTAAATAATGTGATAAAAAAAATTCTTCTATTTCAACATAAAATCTATATATAATCAAGGACATTATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTAAATATCCCATCGTATTGATCTAGGTGTCTTTATTTGTTTCTAGATATCAACGGATTCTAGTACTCTTAATATTGGTTA
TTGCGTGAGTAACAAAACAACCATTTCCTGGTTATTATTGTCATAATTAAGAGTGTTGTTCTGTCTATTTATTACCTAAAATTATCACTCGTCGGTTTGAGTTTTGCTCAACCTATTTAT
TGATATAAAAAAAAAAAATACCACTGTTCAAAAGTTGTGCTTGGAAAAATATTTTAGTGAATTTGGTCATTTCATTTTTTTTCTGGAGAATAAATAATATTTCTTACTATTTTGAAAGAA
AAACACATTTTTTTCCTGTGTAATACCTTCCATTTCCTGCACTGAATTGTGTGTTCCTCTGCCTCTGTAAGAACACTGCCGTACTGAAGAAATGAGAGGATCCTAATTGAATTTTGGCTT
CCCATATTCACTTTTAGTGTTTCAAACTTTCAACTCACTAACAGCAACTTTTCAATAACAGGGGCACATACCATTGGCCTGGCTGAATGAAAAAATTTCCGAGCACACATCTACAATGAT
TCCAACGTTGATCCCTCCCACCGAAAGTCCCTGCAGAGCAAGTGCCCCAGGAGTGGAAATGACAAAATACTCGAACCCCTTGACCACCAAACTCCAATCCATTTCGATANNNNNATCTTC
CAGAATTTGGTGAGTAAAAAGGCCCTTCTTCATTCTGATCAGGAGCTCTTCAATAGCAGTTCTACTGACAATCTGGTAAGAAAATATGCTGCCAACTACTNNGCTGCATTCTTTGAAGAC
TTTGCCAAGGGCATGGTCAAAATGAGCAACATCAAGCCTCTCACAGGAAGCAAAGGCCAGATCAGAATCAATTGTGGGAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTACTACTTCCTCCTCTTGCTAGTTCTCGTTGGTGCAACTACAGCAGCTTCTGAGGAAGAGCTATGCACAGACTTTTACTCCTGCACCTGCCCAAACTTGTTGCCTATAGTG
AAGAAAGGAGTGGCCAAAGCCATTCAGAAAGAACCACGCATGGGGGCTTCCTTACTCCGATTGCATTTCCATCACTTCTTTGTAAAC
GGTTGTGATGCACCAATACTGTTGGATGATACA
AGCAACTTCGTTGGAGAGCAAACAGCAGAAGCTAACAATCAATCAGCTAGAGGGTTCAACGTGATTAATGATATTAAGGCCAATGTGGAGAAAGAATGCCCCAGAGTGGTGTCATGTGCT
GATATTCTTGCTCTGGCAGCTCGAGATTCTGTAGTT
CATTTGCAGTTAGGAGGACCTACTTGGGAAGTGGGGTTGGGGAGAAGAGCTTCTACTACAGCATGTAGAAGTGATGCTAATAAC
AACATTCCCGGGCCTTTCCTCAGTCTATCTGCTCTCATAAACAATTTTGCTAATCAAGACCTCTCAGTTACAGACTTGGTGGCTCTTTCAGGTGTTATAATATATTTGAGATGTCTTAAG
TCAGTTAAAATATATGCCTCCCAACAAAAAATAATCCCTCATTTTAATAAA
TCCCTGCAGAGCAAGTGCCCCAGGAGTGGAAATGACAAAATACTCGAACCCCTTGACCACCAAACTCCA
ATCCATTTCGATANNNNNATCTTCCAGAATTTGGTGAGTAAAAAGGCCCTTCTTCATTCTGATCAGGAGCTCTTCAATAGCAGTTCTACTGACAATCTGGTAAGAAAATATGCTGCCAAC
TACTNNGCTGCATTCTTTGAAGACTTTGCCAAGGGCATGGTCAAAATGAGCAACATCAAGCCTCTCACAGGAAGCAAAGGCCAGATCAGAATCAATTGTGGGAA

Retrieve as FASTA