Entry information : GmPrx126 (Glyma03g04660.1)
Entry ID 8946
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-23 (Christophe Dunand)
Peroxidase information: GmPrx126 (Glyma03g04660.1)
Name (synonym) GmPrx126 (Glyma03g04660.1)
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx126
start..stop
S start..stop
GmPrx128 552 0 1..321 1..319
GmPrx129 551 0 1..321 1..319
GmPrx130 551 0 1..321 1..319
GmPrx131 547 0 1..321 1..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4848601..4848816 216 N° 2 4848076..4848270 195 N° 3 4847039..4847593 555  
complement(join(4847039..4847593,4848076..4848270,4848601..4848816))


exon

Literature and cross-references GmPrx126 (Glyma03g04660.1)
DNA ref. Phytozome 12:   Gm03 (4848816..4847039)
Protein sequence: GmPrx126 (Glyma03g04660.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (296)
PWM (Da):   %s   35236.91 (32387.5) Transmb domain:   %s   i5-24o
PI (pH):   %s   9.34 (9.21) Peptide Signal:   %s   cut: 26 range:26-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASRGYFFVLLHAFVFATLATSAFSKLSPNYYDFSCPKALSTIKSVVEATVKKERRMGASLLRLHFHDCFVNGCDGSVLLDSTSSIDSEKKATPNFKSARGFEVIDDIKKAVDEACGKPVVSCADIVAVAARDSVVALGGPTWKVELGRRDSTTASRKAANANIPAPTFNLSQLITNFKNHGLDEKDLVVLSGGHSIGFARCIFFRNHIYNDSNNIDPKFAKRLKHICPKKGGDSNLAPLDKTGPNHFEIGYYSNLVQKKGLLHSDQELFNGGYTDALVRQYSYGHVAFFEDFANSMIKMGNTRPLTGNQGEIRVNCRKVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). Incorrect prediction from phytozome (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCGCGTGGGTATTTCTTTGTTCTTCTCCATGCTTTTGTGTTTGCGACTCTTGCAACCTCAGCTTTCTCAAAATTGTCACCTAATTACTATGATTTCTCGTGCCCTAAAGCTTTG
AGCACCATCAAAAGTGTCGTGGAGGCCACGGTGAAGAAAGAGCGTCGTATGGGCGCATCCTTGCTACGCTTGCACTTCCATGATTGTTTTGTTAAC
GTAAGACATTCTATTCTTGTATAC
AAATCCCATAAAAAAATTGTTTTGAAAGAAAAAAAAATTAACAAGTTATATTTTTCGTGTACTTTGAGAAAATTTAAGTTATAATTTGTTAAAATATTCTTACACAAAATAAGTATATAC
TAGTATATGTTAACAATATGACACGTATATGTAATTATTTTTTTAATCATAAGATGCGTGTTTATATTACCTTAAACACCATTTATATCATTTAAGAAATGTGAGGAGTAATTCATAACT
AGATTATTTAAATATTTGAGATTAAGTGTCTAACAACTATAACTTGGTTTTGTGAGGGTGATTTAGGGTTGTGATGGTTCAGTTCTTCTAGACTCCACATCCTCCATTGACAGCGAAAAG
AAAGCAACTCCTAATTTCAAATCTGCAAGAGGATTTGAAGTGATTGATGATATCAAGAAGGCTGTGGACGAAGCATGTGGAAAACCAGTTGTTTCTTGTGCTGACATAGTGGCTGTTGCC
GCTCGTGACTCCGTGGTTGCG
GTGAGTAATATTACTACTAGTCTACAACATTATTACTAATTATATTCCCAAATACAATCTATTCTTTAAATAGGTTTATCTATATAGTATATAGTACAG
TATGTAATATAATGTTTTTCTGCGATTAACGTTTTGACTTCAATCAGTCGGTGGTATACAAGTATACGAGGAGGAAGATATGCATTAATTGTTTTCCAAAAACTATGACCAGTCAAAAGT
CAAAAGTCAAATAACGTAATAGTACAGTATAGATTTATTATCTAGGGACTCAGCGACTCAATTTGGATATTTAGAGCAGGACTATAATTCTCAAGTCTCAACCCACCTGCAAAAATGGTC
ACAAAAGATTTAATTCAAACATGCTTAATTTTAATTAATGTACTTCTATCACAATGTTTAACCATCAGAGTGATTTTTAATTCAATTTTTTATATATTGATTTCTTAATTAGTTGTGAAT
ATAAATTATACATTTTCATGCAGTTAGGTGGACCAACATGGAAAGTTGAACTAGGAAGAAGAGATTCCACTACAGCAAGCCGTAAAGCAGCAAATGCAAACATTCCAGCACCAACTTTTA
ACCTATCTCAACTAATCACCAACTTCAAGAACCATGGTCTTGATGAAAAGGACCTTGTTGTTCTTTCTGGAGGCCACTCCATTGGATTTGCACGTTGTATTTTTTTCAGGAACCATATCT
ACAATGACTCCAACAACATCGATCCCAAATTTGCAAAACGTCTCAAACACATTTGCCCTAAAAAAGGTGGTGACTCCAACCTTGCTCCTTTGGACAAAACCGGACCGAATCACTTTGAAA
TTGGCTATTACTCTAATTTGGTTCAAAAGAAAGGGCTTCTTCATTCTGATCAAGAACTTTTCAATGGTGGCTATACTGATGCACTGGTTAGACAGTACAGCTACGGTCACGTAGCTTTCT
TCGAGGATTTCGCGAATTCGATGATTAAGATGGGAAATACTCGGCCCCTTACTGGGAATCAAGGTGAAATCCGTGTTAACTGCAGGAAAGTGAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCGCGTGGGTATTTCTTTGTTCTTCTCCATGCTTTTGTGTTTGCGACTCTTGCAACCTCAGCTTTCTCAAAATTGTCACCTAATTACTATGATTTCTCGTGCCCTAAAGCTTTG
AGCACCATCAAAAGTGTCGTGGAGGCCACGGTGAAGAAAGAGCGTCGTATGGGCGCATCCTTGCTACGCTTGCACTTCCATGATTGTTTTGTTAAC
GGTTGTGATGGTTCAGTTCTTCTA
GACTCCACATCCTCCATTGACAGCGAAAAGAAAGCAACTCCTAATTTCAAATCTGCAAGAGGATTTGAAGTGATTGATGATATCAAGAAGGCTGTGGACGAAGCATGTGGAAAACCAGTT
GTTTCTTGTGCTGACATAGTGGCTGTTGCCGCTCGTGACTCCGTGGTTGCG
TTAGGTGGACCAACATGGAAAGTTGAACTAGGAAGAAGAGATTCCACTACAGCAAGCCGTAAAGCAGCA
AATGCAAACATTCCAGCACCAACTTTTAACCTATCTCAACTAATCACCAACTTCAAGAACCATGGTCTTGATGAAAAGGACCTTGTTGTTCTTTCTGGAGGCCACTCCATTGGATTTGCA
CGTTGTATTTTTTTCAGGAACCATATCTACAATGACTCCAACAACATCGATCCCAAATTTGCAAAACGTCTCAAACACATTTGCCCTAAAAAAGGTGGTGACTCCAACCTTGCTCCTTTG
GACAAAACCGGACCGAATCACTTTGAAATTGGCTATTACTCTAATTTGGTTCAAAAGAAAGGGCTTCTTCATTCTGATCAAGAACTTTTCAATGGTGGCTATACTGATGCACTGGTTAGA
CAGTACAGCTACGGTCACGTAGCTTTCTTCGAGGATTTCGCGAATTCGATGATTAAGATGGGAAATACTCGGCCCCTTACTGGGAATCAAGGTGAAATCCGTGTTAACTGCAGGAAAGTG
AACTAG

Retrieve as FASTA