Entry information : GmPrx134 (Glyma03g04870.1)
Entry ID 8954
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-10-18 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx134 (Glyma03g04870.1)
Name (synonym) GmPrx134 (Glyma03g04870.1)
Class Class III peroxidase     [Orthogroup: Prx129]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx134
start..stop
S start..stop
MtPrx32 392 2e-137 5..326 2..340
MtPrx24 391 4e-137 15..326 12..338
AhPrx04 386 2e-135 7..326 3..316
GmPrx[P]95 380 1e-133 28..320 5..295
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5066957..5067187 231 N° 2 5066482..5066679 198 N° 3 5064837..5065002 166 N° 4 5064367..5064752 386
complement(join(5064367..5064752,5064837..5065002,5066482..5066679,5066957..5067 187))


exon

Literature and cross-references GmPrx134 (Glyma03g04870.1)
DNA ref. Phytozome 12:   Gm03 (5067187..5064367)
Protein sequence: GmPrx134 (Glyma03g04870.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (300)
PWM (Da):   %s   35696.26 (32826.8)  
PI (pH):   %s   8.34 (8.38) Peptide Signal:   %s   cut: 27 range:27-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTMSATFPELKLRICLFLCLICIASADSANELRPDFYNSQCSQALQVIKKEVTAAVRKDPAIGAALIRRQFYDCFVQGCDASVLLKDTANFTGEQSVIPDVDSTNGTDIILIEKIKARLEKLCPDVVSCADIIAVAAKDSVVALGGPTWNVLLGRRDSTTANLSAVLTDFPTTFMNLTELLATFGKKNFTAQEMVAFTGAHTTGRIKCLFFRTRIYNESNINPSYARSLQAKCPFVGGDDNLAPLDRTTPILFDNAYYKNLLKQKGLLHSDQQLYNNGSTDTIVEFYAKNPLGFRTDFAKVMTKMGNLSPLTGTNGQIRKQCSKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from Phytozome (5' end is missing). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCATGTCTGCAACTTTTCCAGAACTTAAACTCAGGATTTGTTTGTTTTTATGCCTTATTTGTATAGCTTCAGCAGATTCTGCTAATGAGTTACGCCCAGACTTTTATAATTCACAA
TGTTCCCAAGCACTTCAAGTCATTAAGAAAGAAGTAACCGCTGCTGTGAGGAAAGACCCTGCCATTGGTGCAGCCTTGATTCGTCGCCAATTCTATGATTGCTTTGTCCAA
GCAAGTTTT
CATTATCCAAAAACTTTATGCTTTGCTTATGAAAAGTTTCATGCAATATGCTTTTTCTGTATGCATAAGTTCCAATAGTCCTTCTATATGTGAAATTAAACTACATTATTTACTTAACAA
TTAAAAACCACCCAAAGTATCATAGTCACACACTCACACACACACAAACTTTTAGAAGGTATGTAAAACAAAAGAAGAAAACCTTGATTATCTAAACCGGTTTTTAGAAAAGTTTATCTT
GATTTTTTATGCTTTTAATATTGTATAGGGATGTGATGCATCAGTGTTACTGAAAGACACAGCAAATTTCACGGGTGAACAAAGTGTCATTCCCGATGTTGATTCTACAAATGGTACGGA
TATCATACTCATAGAGAAGATAAAAGCTAGACTGGAGAAACTGTGTCCTGATGTTGTCTCTTGCGCTGACATTATAGCTGTTGCTGCAAAAGATTCTGTCGTTGCG
GTAAGTACTCAAAT
TGTTGGAGAAACAACAATATGTTTCTGGCATATTAAGAAAGAAAAGTTACTTGAACACCTAGAGCTTGCTTACACTAAGAGAGATAGGAAGAGAGAAAAAATAAGTGATTAATTTGAGAA
AATTGATTCTTTAACTTGCATGAGGGTGTGTAAATATTTTGAGAAATAAAAAGAGAAAAAGATAAATGATTGATGGAATTAATTATATGATGTGATAAAAAAATGATAAAGAGAAACAAA
ATGTTTATAAAATATTTGTAAATTATGAGTGTTTAAATATTATCATTCTTGATATAATTGGAGATCATTATATAGCATAAAGAGACAGAGAGAAGATGAACGTCAATGAAATGTTTGATA
GATAGAATGATGATATTTAAACATTCATATTTTTTTAACATGACACGTTAAAATATTGATAATACCTATATTTTTCTTATTTAAATACCTCTCTCACTAGTGTCTATTGGAAACTTGATT
GTCTATAAATAATTTTTCTTATTAAGATGTCAAACCAATTCAAAATATATATTATTATTAGATAGTCTTCAACAACTATATATTTATGGTCTTAATTAATTTTTATTCCATACATTTAAG
TTTTTCAAAATATTAATAACATTTAATTATATATCATATAAAAATTATTTGAGATCATGGTCTTAGACCACCATACAATTTCTCTGCAAAATGAAGATGACTTTATATATTATAGATGAT
AATTTTTGTACACATATTAAAATACAAACACATTATTAATATCTCTTATTCTTCCTTCCTCTCTCTATATCTCTCTTAATTTATGTCACATCACATATCATCAATTATATTCATAATCTA
TCTCTTCTTTATCCTTATATCTCTTTGGGTGTAGACACCAAAAAACTATTCAACAATTTTTTTAATATATTGTCCTATGTCTCACACACAACCACATATTTACTTATATTTCAATTATGG
TTTGAGGACCTAAAATTGTGTCTGCACATATGTATTTACTTCTATTTAAATTATGGTTTGAGACCTAAAGTTGTGTTCAAACACAATTTAACTATGATTGCTCTACACAAATTATATATT
TATGGATGAAGCTCGTTCTATATTCTCCTCCAAACTAACATATAATAATGTACACAAACTATTATTTAAACGTGTAACAAAACTGTCAAATTAAGATTTTCCTGTACAACTTGTATTTTT
CAAACCTTATAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNCCAACATTGATGTATATATGTATGAATAGTTTAATTTGTGTAGTGTCAAATGATTCTCTTTTCCATTTCTGCATATGTATTTTACTGACGTGTGTGATGT
CTGATGGATGATACATGATTCCCAGCTCGGTGGACCTACTTGGAATGTTCTCTTGGGTAGAAGAGACTCAACAACTGCCAATCTAAGTGCTGTTTTAACAGATTTTCCCACTACTTTTAT
GAATCTTACTGAACTTCTTGCTACGTTCGGGAAAAAAAATTTCACAGCCCAAGAAATGGTTGCTTTTACAG
GTTAATTAATTCCCATAATGGATTCTGATTTTATTTTGCTATATATAGT
AAATATTCACAGAAATTAAATTTGTTGTTCATCAGGTGCTCACACTACAGGTAGAATCAAATGTTTATTCTTTCGAACAAGGATTTACAACGAAAGCAATATAAATCCCTCGTATGCAAG
ATCGTTGCAAGCTAAGTGTCCATTCGTAGGTGGTGATGACAACTTAGCTCCTTTAGATCGAACCACTCCAATCCTTTTTGACAATGCTTATTACAAGAATTTGCTGAAGCAAAAGGGTCT
TTTACACTCTGATCAACAGCTCTATAACAATGGTTCCACGGACACGATTGTTGAATTTTATGCAAAGAACCCTTTGGGGTTTAGAACAGATTTCGCTAAAGTAATGACTAAGATGGGTAA
CCTTAGTCCACTTACCGGCACCAACGGGCAGATTAGAAAGCAATGCAGCAAAGTCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCATGTCTGCAACTTTTCCAGAACTTAAACTCAGGATTTGTTTGTTTTTATGCCTTATTTGTATAGCTTCAGCAGATTCTGCTAATGAGTTACGCCCAGACTTTTATAATTCACAA
TGTTCCCAAGCACTTCAAGTCATTAAGAAAGAAGTAACCGCTGCTGTGAGGAAAGACCCTGCCATTGGTGCAGCCTTGATTCGTCGCCAATTCTATGATTGCTTTGTCCAA
GGATGTGAT
GCATCAGTGTTACTGAAAGACACAGCAAATTTCACGGGTGAACAAAGTGTCATTCCCGATGTTGATTCTACAAATGGTACGGATATCATACTCATAGAGAAGATAAAAGCTAGACTGGAG
AAACTGTGTCCTGATGTTGTCTCTTGCGCTGACATTATAGCTGTTGCTGCAAAAGATTCTGTCGTTGCG
CTCGGTGGACCTACTTGGAATGTTCTCTTGGGTAGAAGAGACTCAACAACT
GCCAATCTAAGTGCTGTTTTAACAGATTTTCCCACTACTTTTATGAATCTTACTGAACTTCTTGCTACGTTCGGGAAAAAAAATTTCACAGCCCAAGAAATGGTTGCTTTTACAG
GTGCT
CACACTACAGGTAGAATCAAATGTTTATTCTTTCGAACAAGGATTTACAACGAAAGCAATATAAATCCCTCGTATGCAAGATCGTTGCAAGCTAAGTGTCCATTCGTAGGTGGTGATGAC
AACTTAGCTCCTTTAGATCGAACCACTCCAATCCTTTTTGACAATGCTTATTACAAGAATTTGCTGAAGCAAAAGGGTCTTTTACACTCTGATCAACAGCTCTATAACAATGGTTCCACG
GACACGATTGTTGAATTTTATGCAAAGAACCCTTTGGGGTTTAGAACAGATTTCGCTAAAGTAATGACTAAGATGGGTAACCTTAGTCCACTTACCGGCACCAACGGGCAGATTAGAAAG
CAATGCAGCAAAGTCAATTGA

Retrieve as FASTA