Entry information : GmPrx136 (Glyma03g30180.1)
Entry ID 8956
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-09 (Christophe Dunand)
Peroxidase information: GmPrx136 (Glyma03g30180.1)
Name (synonym) GmPrx136 (Glyma03g30180.1)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx136
start..stop
S start..stop
GmPrx310 616 0 1..330 1..331
MtPrx23 580 0 4..330 46..373
GmPrx38 551 0 3..330 4..331
GmPrx71 547 0 7..330 9..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 38131022..38131234 213 N° 2 38131415..38131609 195 N° 3 38131766..38131931 166 N° 4 38132904..38133322 419
join(38131022..38131234,38131415..38131609,38131766..38131931,38132904..38133322 )


exon

Literature and cross-references GmPrx136 (Glyma03g30180.1)
DNA ref. Phytozome 12:   Gm03 (38131022..38133322)
Protein sequence: GmPrx136 (Glyma03g30180.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (306)
PWM (Da):   %s   35044.16 (32079.7) Transmb domain:   %s   i2-21o
PI (pH):   %s   4.74 (4.74) Peptide Signal:   %s   cut: 25 range:25-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFSFNYLFTTIFLVLTFFLYPSNAQLSSTFYSSTCPNVSSIVRSVVQQALQSDPRIAASLTRLHFHDCFVNGCDGSILLDVGGNITLSEKTAGPNNNSARGFDVVDNIKTSIENSCPGVVSCADILALAAEVSVSLGGGPSWNVLLGRRDGLIANQSGANTSIPNPTESLANVTAKFAAVGLNITDLVALSGAHSFGRAQCRFFNQRLFNFSGTGSPDPTLNTTYLATLQQNCPQNGSGNTLNNLDPSSPDTFDNNYFQNLLSNQGLLQTDQELFSTNGAATVSVVNNFAANQTAFFQAFAQSMINMGNISPLTGSQGEIRSDCKRVNGS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTTCTTTTAATTACCTATTCACCACCATTTTCTTAGTGCTAACATTCTTTCTTTATCCATCAAATGCTCAACTGAGTTCAACCTTCTACTCCAGCACATGCCCCAACGTGTCTTCC
ATTGTGCGCAGTGTTGTTCAGCAGGCTCTGCAATCTGATCCTCGAATTGCTGCGAGCCTAACTCGTCTTCATTTTCATGATTGCTTTGTTAAT
GTAATGTACACTATCAATTCAAACCTC
CAAATTACAAATTTTCAAGAAGCATGTGTTTATGTAACTGATATCTAAATGAATTTTTAATTTGCTCTCATAATTAACTGTCTGATATATATAATCTAAGCTTTGAGTAGTTTGTATGAA
GGACTAATATTAATAAATATTTTGGTGTTTCAGGGATGTGATGGATCCATTTTGTTAGACGTAGGTGGCAACATAACACTGAGCGAGAAAACTGCAGGTCCCAACAATAATTCGGCTCGT
GGCTTTGATGTGGTCGACAACATAAAGACATCTATTGAAAATTCATGCCCCGGTGTTGTATCTTGTGCTGATATTCTTGCCCTTGCTGCTGAAGTTTCGGTGTCTTTG
GTAATTTACTTG
TTATAATTAGTTAATGATTCTCCTTATCTTATCAAATTTCTTGCAAACCAATACTTAATTATATATATACCATAAAAAATGTTGCAGAGGCATTTACTTTAGAGGGCATAACATAACTGC
ATATTATATATTAATTATTTGCAGGGAGGAGGTCCTTCATGGAACGTACTACTAGGAAGAAGGGACGGTTTGATTGCAAACCAATCTGGTGCGAACACATCCATTCCCAATCCAACAGAA
AGCCTGGCCAATGTCACTGCCAAATTTGCTGCCGTTGGCCTAAACATAACTGATCTCGTTGCATTATCTG
GTAATCATTATTATATTGCTTCCCCCGTCTACTTTCTTGTGTGCACACAC
AAACTTCATACAACATATGTAGTGGAATAAAAAATAATATAAAAGAATTTTTAACAATTCATGTCCTGAAATCAATTGAATTAGATATTCTTAATACATTTGTAACGTACATAAATAGAT
TAATTCTCACTACTTGTTTAATAAGAACTTATCAAACAAATTAAAAATGTCACTTTAATCATATTTCTACTGTTAACATCCATTTTATATCTTAAAACGATTTTTCAACTGTAGACATTG
TAGTGTAAGTTTAGTGCTAGTTCTTTTCAAACGTCACCTAAATACACCTTATTAAATAAAGGAAAAGGCTAACTATTTTTGTTTTTTTTTTTTTTTTACCAATGCTAACTGTTGTTGTTA
GGAAATTAATTAATGAATCAAAAGCGATTTTATTTTTATTTTTTATTTTTGAAAGGAAGCGATTTTTTTTTATTAAAAGTATAACAGTGTATTATTTGAACTTTAAAAAATTTACTTATT
GATTTCTTAACAAGTACCCTAATGATATTATTAACAAGACTCTTAAATAAATATTAATATGATTTTATATATTTGTAAAGTTTAATGTTTATATACTATTAGGGTAAATTCTTTTACATG
ATCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTCATTACATAATTTTTTCGTATTTATAGTGTTTTCTTTCTTCCAAAAACTTTTTTCTTATATTTTCTTAGCTGAATGGCTGACAA
TTTACCTATAGAAAAATGGTTGATTTAATTACATAATTACTATGATGCTTATTAAGTAGTGGTTTTGTTTTGAGTGGAAAAGGTGCACATAGTTTTGGTCGTGCGCAGTGTAGATTTTTC
AACCAGAGACTGTTCAACTTCAGCGGCACAGGTAGCCCTGATCCCACGCTGAATACAACCTATTTAGCGACACTTCAGCAAAACTGTCCACAAAACGGAAGCGGCAACACTCTGAACAAC
CTCGACCCTTCGTCTCCGGACACCTTCGACAACAACTACTTCCAAAACCTTCTCAGCAATCAGGGCCTTCTCCAAACAGACCAAGAGCTCTTTTCCACCAACGGCGCCGCCACAGTTTCC
GTCGTCAACAACTTCGCCGCCAACCAAACCGCGTTCTTCCAAGCCTTTGCTCAGTCCATGATTAACATGGGTAATATTAGCCCGTTGACTGGAAGCCAGGGTGAAATCAGATCAGATTGT
AAAAGGGTCAATGGAAGTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTTCTTTTAATTACCTATTCACCACCATTTTCTTAGTGCTAACATTCTTTCTTTATCCATCAAATGCTCAACTGAGTTCAACCTTCTACTCCAGCACATGCCCCAACGTGTCTTCC
ATTGTGCGCAGTGTTGTTCAGCAGGCTCTGCAATCTGATCCTCGAATTGCTGCGAGCCTAACTCGTCTTCATTTTCATGATTGCTTTGTTAAT
GGATGTGATGGATCCATTTTGTTAGAC
GTAGGTGGCAACATAACACTGAGCGAGAAAACTGCAGGTCCCAACAATAATTCGGCTCGTGGCTTTGATGTGGTCGACAACATAAAGACATCTATTGAAAATTCATGCCCCGGTGTTGTA
TCTTGTGCTGATATTCTTGCCCTTGCTGCTGAAGTTTCGGTGTCTTTG
GGAGGAGGTCCTTCATGGAACGTACTACTAGGAAGAAGGGACGGTTTGATTGCAAACCAATCTGGTGCGAAC
ACATCCATTCCCAATCCAACAGAAAGCCTGGCCAATGTCACTGCCAAATTTGCTGCCGTTGGCCTAAACATAACTGATCTCGTTGCATTATCTG
GTGCACATAGTTTTGGTCGTGCGCAG
TGTAGATTTTTCAACCAGAGACTGTTCAACTTCAGCGGCACAGGTAGCCCTGATCCCACGCTGAATACAACCTATTTAGCGACACTTCAGCAAAACTGTCCACAAAACGGAAGCGGCAAC
ACTCTGAACAACCTCGACCCTTCGTCTCCGGACACCTTCGACAACAACTACTTCCAAAACCTTCTCAGCAATCAGGGCCTTCTCCAAACAGACCAAGAGCTCTTTTCCACCAACGGCGCC
GCCACAGTTTCCGTCGTCAACAACTTCGCCGCCAACCAAACCGCGTTCTTCCAAGCCTTTGCTCAGTCCATGATTAACATGGGTAATATTAGCCCGTTGACTGGAAGCCAGGGTGAAATC
AGATCAGATTGTAAAAGGGTCAATGGAAGTTAA

Retrieve as FASTA