Entry information : GmPrx137 (Glyma03g36610.1)
Entry ID 8957
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2015-11-26 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-26 (Achraf Jemmat)
Peroxidase information: GmPrx137 (Glyma03g36610.1)
Name (synonym) GmPrx137 (Glyma03g36610.1)
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx137
start..stop
S start..stop
GmPrx138 602 0 1..322 1..324
MtPrx04 528 0 1..321 1..320
GmPrx37 499 2.87e-180 1..323 1..323
GmPrx66 488 4.82e-176 24..323 9..310
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8957' 'complement(join(43528802..43529208,43529583..43529739,43529910..43530104,43531426..43531635))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 43531426..43531635 208 N° 2 43529910..43530104 193 N° 3 43529583..43529739 155 N° 4 43528802..43529208 405
complement(join(43528802..43529208,43529583..43529739,43529910..43530104,4353142 6..43531635))


exon

Literature and cross-references GmPrx137 (Glyma03g36610.1)
DNA ref. Phytozome 12:   Gm03 (43531635..43528802)
Protein sequence: GmPrx137 (Glyma03g36610.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (300)
PWM (Da):   %s   35099.13 (32629.8) Transmb domain:   %s   i5-25o
PI (pH):   %s   9.63 (9.74) Peptide Signal:   %s   cut: 23 range:23-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKIRFFLVACLAVFCVLGVCQGGNLRKKFYRKSCPQAEQIVRTKIQQHVSACPNLPAKLIRLHFHDCFVRGCDGSVLLDSTATNIAEKDAIPNLSLAGFDVIDDIKEALEAKCPGIVSCA
DILALAARDSVSAVKPAWEVLTGRRDGTVSVSGEALANLPAPFYNFTTLKASFASKNLNVHDLVVLSGAHTIGIGHCNLFSKRLFNFTGKGDQDPSLNPTYANFLKTKCQGLSDNTTTVK
MDPNSSNTFDSNYYSILRQNKGLFQSDAALLTTKMSRNIVNKLVKKDKFFTKFGHSMKRMGAIEVLTGSAGEIRRKCSVVNA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGATAAGATTTTTTCTTGTAGCTTGTTTGGCAGTGTTCTGTGTCTTAGGGGTTTGTCAAGGAGGCAACCTCAGAAAGAAATTCTACAGGAAATCCTGTCCTCAAGCCGAGCAGATT
GTTAGGACCAAAATCCAGCAACATGTCTCTGCATGCCCCAATTTGCCTGCCAAGTTGATTAGATTGCATTTTCATGACTGTTTTGTCAGG
GTAAGCATTTCTAGCTCTTTATCAATATTT
ACACCCACTGGCTGAGCTTGAGATAAATTAAGTTTTGGAGGCCCCGGCTAAAATAGTTAGAATTTTAATACCTATAACTATTTAGATTATATTTTAATGACACTTCTCAAGCTTCTTTTT
AATTGCAACTTCTAAACTATCATATGCTACTTAATAAAAATAATGGAAAAAATAAATGTAAAAATTATGTGATTAAAAAAAATACATTGGAAGTGTTTGTTTCATGTAATCTTATTAAAT
TATCAGGAATACAAAGCTAGAAATATATATTCTTGTGTTTTGTTAGAAGGTAATTAAAAAATATTGTTAGACATAACTCATTTTTAATAATTTAGTTTGTACATGTTTCTCCGTCTTTTT
ATTTTAGGTAAAGGGATGAGAATCTTATATTGAATGCTTAAAAAATAATTCCTCGTTTTTTTTCTTATTCAACCTCATTTGTTTATTTATTTAATATTTTTATTTTTAAATTAAAATAAA
TTTAAAAACATTCCCATAAATTAAAAATATGTGCCAAATATCTTTGATGAGAATAAGATTCCTAAAAATAGCATTCCCAAAAATATTATTTCTGAAAATATAATCAAATCTGTGAAACAA
ATGCTCAATTATTTTTTTTACATAAAACAATATATGCATTGGAATGCCTATAAACTTTATCTAAATTTTTTCAACAAACTAAAGAGAATATAATATTTTTGCCAAAATTATAACACAATT
GGCACAAAAAATTTGTAGAAAAAATCACAAGAATACCACAAAAATATATAGGCAATTTTTGCATAAAAAACTGTATTTTAAGTTATGTTGTATATGTTTTCGATAGTAAAATGAGATTAT
AAAAGTTATAGTTTTTTTTTTGAAAAATGAATTTTTTTTATGAAAACATAATTAATTAATGAAATAGTAAATATATAAAAATGTTATTAATAAGGGTCTTAAAGTTCAATATTAATATAA
AATCATCTATAAAAATAACTTTAAAATTTTTGTATACTCTTTCAATTATTTAAAACCATTAATTTATTAAGGAACGAATAACTTTAAAGAATATCTGAAAACAATGTAACTTTTTATTAA
TATCCAATAAAAATTGAAATAATTATATATAATAATAATAATAATAATAATAAATTTGTGGAAATTTTTGGGGGTCATGCCCCATTCATGGAGAACTAAACTCCGCCACTGTTTACACCC
TATGTGTGTCATTTCAAATTTAAATGTAACAATGCTAATTTCCATGCAGCATGTTTTGGAGCTACATATATAATTGAAACAACATTTTCAGGGGGTTGTGATGGCTCAGTTTTGCTGGAC
TCCACTGCCACCAACATTGCAGAGAAGGATGCCATTCCCAATTTATCTTTGGCTGGCTTTGATGTCATAGATGACATTAAAGAAGCATTGGAGGCTAAATGTCCCGGAATTGTATCTTGT
GCTGACATACTAGCTTTGGCAGCTAGGGATTCTGTTTCTGCAGTCAAA
GTAAGCTATGGCTAACCCTCCTATTAATTACTCTATGCCTGCAGATTATAAACACAATTTTAGTTTATATAT
ATATATATACACACACTACAGAACTTGCATATGTTTTCATACAATAATGTTAGTTTATGCATGTAGCTGATTGATGATAATATTTGCATTTTAATAAGCCCCTGCGTGGGAAGTGCTTAC
CGGTAGAAGAGATGGCACAGTATCCGTAAGTGGTGAAGCCTTGGCCAATCTGCCGGCACCTTTCTACAATTTCACCACGCTCAAAGCAAGCTTTGCTAGTAAAAATCTTAATGTGCACGA
CCTGGTTGTATTATCAG
GTACATTTTATTTTTTTGTCTTGCTTACCTTAATGGACTCATAAGAAATTAAAAGAAAAAAGTATTTAATATAAAAATCACAAGAGAATGTAAAAAATATCAT
GAGCATAATTTTTTGTTTATCCCAATAAAAATATTTTTACTTTACCTTAACTAGTAATCGAAGAGTTCTTATTAGCATTTTTTTATTTATAAATTCATGCCAAACATGCATAATATTAGT
GATAAATAATAAGGACAAAACTTAGATGATGTTCCTTTCTTTTGGAACTGCTTTCACATCAATATTGGGATTTCACTTCAGTGATTCATACAGCACAATCATCTATTAAAATTAGGGGCT
AAATTAACCTATTGGCTATGTGTGTATATAGGAGAGCTCACACAATTGGGATAGGTCACTGTAACTTATTCAGTAAAAGGCTTTTCAACTTCACCGGAAAAGGTGATCAAGATCCTTCTT
TGAACCCTACTTATGCCAATTTCTTGAAGACAAAATGCCAAGGTCTCAGTGACAACACTACAACAGTAAAGATGGATCCTAACAGCTCAAACACCTTTGACAGTAACTATTATTCTATCC
TTCGCCAGAACAAGGGTCTATTCCAATCAGATGCTGCCCTTTTAACAACAAAGATGTCAAGAAACATTGTCAACAAATTGGTCAAAAAAGACAAGTTCTTCACAAAGTTTGGGCATTCAA
TGAAGAGAATGGGAGCAATTGAGGTTCTCACAGGCTCCGCTGGGGAAATTAGGAGGAAGTGCTCTGTTGTCAACGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGATAAGATTTTTTCTTGTAGCTTGTTTGGCAGTGTTCTGTGTCTTAGGGGTTTGTCAAGGAGGCAACCTCAGAAAGAAATTCTACAGGAAATCCTGTCCTCAAGCCGAGCAGATT
GTTAGGACCAAAATCCAGCAACATGTCTCTGCATGCCCCAATTTGCCTGCCAAGTTGATTAGATTGCATTTTCATGACTGTTTTGTCAGG
GGTTGTGATGGCTCAGTTTTGCTGGACTCC
ACTGCCACCAACATTGCAGAGAAGGATGCCATTCCCAATTTATCTTTGGCTGGCTTTGATGTCATAGATGACATTAAAGAAGCATTGGAGGCTAAATGTCCCGGAATTGTATCTTGTGCT
GACATACTAGCTTTGGCAGCTAGGGATTCTGTTTCTGCAGTCAAA
CCTGCGTGGGAAGTGCTTACCGGTAGAAGAGATGGCACAGTATCCGTAAGTGGTGAAGCCTTGGCCAATCTGCCG
GCACCTTTCTACAATTTCACCACGCTCAAAGCAAGCTTTGCTAGTAAAAATCTTAATGTGCACGACCTGGTTGTATTATCAG
GAGCTCACACAATTGGGATAGGTCACTGTAACTTATTC
AGTAAAAGGCTTTTCAACTTCACCGGAAAAGGTGATCAAGATCCTTCTTTGAACCCTACTTATGCCAATTTCTTGAAGACAAAATGCCAAGGTCTCAGTGACAACACTACAACAGTAAAG
ATGGATCCTAACAGCTCAAACACCTTTGACAGTAACTATTATTCTATCCTTCGCCAGAACAAGGGTCTATTCCAATCAGATGCTGCCCTTTTAACAACAAAGATGTCAAGAAACATTGTC
AACAAATTGGTCAAAAAAGACAAGTTCTTCACAAAGTTTGGGCATTCAATGAAGAGAATGGGAGCAATTGAGGTTCTCACAGGCTCCGCTGGGGAAATTAGGAGGAAGTGCTCTGTTGTC
AACGCTTAA

Retrieve as FASTA