Entry information : GmPrx151 (Glyma06g06350.1)
Entry ID 8960
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2015-12-15 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-12-16 (Achraf Jemmat)
Peroxidase information: GmPrx151 (Glyma06g06350.1)
Name (synonym) GmPrx151 (Glyma06g06350.1)
Class Class III peroxidase    [Orthogroup: Prx028]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx151
start..stop
S start..stop
GmPrx295 505 0 8..326 12..330
GmPrx[P]322 499 1e-180 5..326 7..302
GmPrx67 498 2e-179 13..326 16..329
MtPrx114 494 6e-178 1..325 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4553835..4554055 221 N° 2 4553312..4553491 180 N° 3 4553046..4553211 166 N° 4 4552024..4552439 416
complement(join(4552024..4552439,4553046..4553211,4553312..4553491,4553835..4554 055))


exon

Literature and cross-references GmPrx151 (Glyma06g06350.1)
DNA ref. Phytozome 12:   Gm06 (4554274..4552024)
Protein sequence: GmPrx151 (Glyma06g06350.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327
PWM (Da):   %s   35228.53 Transmb domain:   %s   i7-24o
PI (pH):   %s   5.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
METRTGTLSITVCSLVMFSFVSLVKGSLSFNFYAASCPSAESIIRNIVSSSSSTDPTIPGKLLRLVFHDCFVEGCDASLMLQGNNTEQSDPGNRSVGGFTVIDSAKRILEKFCPGTVSCADIIALAARDAVEIAGGPRTMIPTGRRDGMVSVASNVRPNIVDTSFSMDEMVKLFASKGLSLLDLVILSGAHTIGTAHCSSFRDRFQEDSKGKLRLIDKTLNSDYANELIKQCPAGVQPSVTVNNDPETSMAFDNMYYQNLLAHKGLFQSDSVLISNDSTRKLVVDFANDQELFFENWDQSFLKLTSVGVKTGDKGEIRISCASTNA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGACAAGAACAGGAACTCTTTCCATAACAGTTTGTTCTCTTGTTATGTTTTCTTTTGTTTCCCTTGTAAAGGGTAGCCTCTCTTTCAACTTCTATGCAGCTTCATGTCCATCAGCA
GAGTCTATCATAAGAAACATAGTCAGCTCATCCTCTTCTACTGATCCTACTATTCCTGGAAAGCTTCTTCGCTTGGTTTTCCATGATTGCTTTGTGGAG
GTTAGCGTTCAACTTCTTCAT
GAAATGTGCTTTTCTTCTGCTTGTAATGTACTTAATTTAGCTACCAATATATTATAATGCACCCCTTTTTTGGAGATCACATTTTCTGTTTACTTTGTTTTATTATAACCTTTTCCTAAG
TAACTTGTCTCCCAATTAAACATTCAACAAATACAAAACCAATTGTGTAATGGAAAATTCAAATGTGATTGAAGTGAAGATGACCAAAGAGGTTGCATGCATTTGCAATTGTTGCTTACA
GTGAGTTTGCATGTATTTACAATTCTTTGTAGCTTGCAGTGAATTATTTCCTTGATGAAATGGATCACTTTATTATATGCAGGGATGTGATGCTTCTTTGATGCTACAAGGGAACAATAC
AGAACAAAGTGATCCAGGAAATAGGTCTGTTGGAGGATTTACAGTTATAGATTCAGCAAAAAGGATCCTTGAGAAATTCTGCCCTGGAACTGTTTCTTGTGCAGACATAATAGCTCTAGC
CGCTAGAGATGCTGTTGAAATA
GTAAGTTCTACCTCAATGCATGGCTGATATTGTTCAATGGTATATATAGACATGACATCTCTTTTGGTACGGTTATTAACTGAAGGGCACGTGAGAAC
AGGCTGGTGGACCAAGGACTATGATTCCTACAGGTAGGAGAGACGGGATGGTTTCAGTTGCTTCAAATGTCAGACCTAACATTGTGGACACCAGTTTTTCAATGGATGAGATGGTTAAAC
TCTTTGCTTCTAAAGGACTGTCCTTACTTGATCTTGTCATCCTTTCAG
GTGCATATTCTGTGTCCAAAGCACAAATAGTTGTTACATGTAACTTTCAAGAGAATGGTTTTATCTAAAGCA
AATTACACTGACACGCCTGTAATTTCTTGAGATCGTGCACAATACCTATGTCTTTTTAACCTTTACAGTAACCCCTTTACAATAGTACATAGTGTAATAATGTGCTTATTGGATATCAAA
GAATATGATTGTAATGTATTTCTAACAATTAAGGAGATCAGTTACCATGAGAGTTAAAAAGGTAGGATTATGGTGTGCAATCTCACGAGGTGTAAATGTAATTTGCTTTATTAGTGTTTG
GTTTGCTTATTTTAACAATCACCTTTCCTTTGATTTTTAGCCTCCTAATACTATGAGTTGAGATCTATACTATTCACATTCCACAATTTACTAGAGCTTTGAGCATTTGGTGTTCTATAA
ACATTTTTGGACTGTTTATCTTTTCTAAATTTTGGATATATTCAAACCAAGGTGTTTGAAATTAGTATCTGATAATGTAATTTATTGTCAACCATTACACATGTTAACCTTTCACACTGT
TTGCTTTGATATCATGCTAGTACATACTTATTTAGTATTTTTTAAGCTTTTCAGGAGCTCATACCATAGGGACAGCACATTGCAGCTCATTCAGGGATCGTTTTCAAGAAGATTCAAAGG
GAAAGCTTAGGCTCATTGACAAAACCCTTAACAGTGACTATGCTAATGAGCTAATAAAACAGTGTCCAGCAGGTGTCCAACCATCTGTAACAGTGAACAATGATCCTGAAACATCTATGG
CCTTTGACAACATGTACTACCAAAATCTTCTGGCCCACAAAGGGCTATTCCAATCAGATTCTGTTTTGATAAGCAATGATAGCACAAGGAAGTTAGTGGTGGATTTTGCAAATGATCAAG
AGCTTTTTTTTGAAAATTGGGATCAGTCTTTCTTGAAGCTCACTAGTGTTGGAGTAAAAACTGGTGATAAGGGTGAAATTCGAATTTCTTGTGCATCGACTAATGCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGACAAGAACAGGAACTCTTTCCATAACAGTTTGTTCTCTTGTTATGTTTTCTTTTGTTTCCCTTGTAAAGGGTAGCCTCTCTTTCAACTTCTATGCAGCTTCATGTCCATCAGCA
GAGTCTATCATAAGAAACATAGTCAGCTCATCCTCTTCTACTGATCCTACTATTCCTGGAAAGCTTCTTCGCTTGGTTTTCCATGATTGCTTTGTGGAG
GGATGTGATGCTTCTTTGATG
CTACAAGGGAACAATACAGAACAAAGTGATCCAGGAAATAGGTCTGTTGGAGGATTTACAGTTATAGATTCAGCAAAAAGGATCCTTGAGAAATTCTGCCCTGGAACTGTTTCTTGTGCA
GACATAATAGCTCTAGCCGCTAGAGATGCTGTTGAAATA
GCTGGTGGACCAAGGACTATGATTCCTACAGGTAGGAGAGACGGGATGGTTTCAGTTGCTTCAAATGTCAGACCTAACATT
GTGGACACCAGTTTTTCAATGGATGAGATGGTTAAACTCTTTGCTTCTAAAGGACTGTCCTTACTTGATCTTGTCATCCTTTCAG
GAGCTCATACCATAGGGACAGCACATTGCAGCTCA
TTCAGGGATCGTTTTCAAGAAGATTCAAAGGGAAAGCTTAGGCTCATTGACAAAACCCTTAACAGTGACTATGCTAATGAGCTAATAAAACAGTGTCCAGCAGGTGTCCAACCATCTGTA
ACAGTGAACAATGATCCTGAAACATCTATGGCCTTTGACAACATGTACTACCAAAATCTTCTGGCCCACAAAGGGCTATTCCAATCAGATTCTGTTTTGATAAGCAATGATAGCACAAGG
AAGTTAGTGGTGGATTTTGCAAATGATCAAGAGCTTTTTTTTGAAAATTGGGATCAGTCTTTCTTGAAGCTCACTAGTGTTGGAGTAAAAACTGGTGATAAGGGTGAAATTCGAATTTCT
TGTGCATCGACTAATGCATAA

Retrieve as FASTA