Entry information : GmPrx163 (Glyma07g33180.1)
Entry ID 8964
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-21 (Christophe Dunand)
Peroxidase information: GmPrx163 (Glyma07g33180.1)
Name (synonym) GmPrx163 (Glyma07g33180.1)
Class Class III peroxidase    [Orthogroup: Prx024]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx163
start..stop
S start..stop
GmPrx17 644 0 1..338 1..338
GmPrx60 504 0 20..338 22..332
PpePrx08 472 5.68e-169 1..337 1..332
RcPrx31 447 5.26e-159 1..338 1..336
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8964' 'join(38099848..38100093,38101069..38101260,38101395..38101560,38101875..38102287)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 38099848..38100093 244 N° 2 38101069..38101260 190 N° 3 38101395..38101560 164 N° 4 38101875..38102287 411
join(38099848..38100093,38101069..38101260,38101395..38101560,38101875..38102287 )


exon

Literature and cross-references GmPrx163 (Glyma07g33180.1)
DNA ref. Phytozome 12:   Gm07 (38099848..38102287)
Protein sequence: GmPrx163 (Glyma07g33180.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338 (310)
PWM (Da):   %s   38046.71 (33979.1) Transmb domain:   %s   i5-27o
PI (pH):   %s   5.91 (8.20) Peptide Signal:   %s   cut: 23 range:23-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSCRIVIYFTFFFCLFFTSVPLVHMYPSYPYSRNYQLDLNFYDRS
CPNLHKIVGYGVWLALRNDNRMAASLLRLHFHDCIVN
GCDASVLLDDTPYFTGEKNALPNHNSLRGFEVIDDIKEHLERICPSTVSCADILALAAREAIDQIGGPSWPVQLGRRDATTTSKEAAEQQIPSPIEPLENITAKFFSKGLDMKDVVALSG
AHTIGFARCFTFKRRLFDFQGSGRPDPVLEFSLLSKLQNMCPNEDASNSNLAPLDATSTMMFDNEYYRNIVYNTGLLESDQALIKDRRTAPTVYYYSNNQFSFYNDFAESMVKLSNVGVL
TGTEGQIRYKCGSVNY

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Incorrect prediction from phytozome (3' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTTGTAGAATTGTGATCTACTTCACTTTCTTCTTCTGTTTGTTTTTTACCTCGGTTCCTCTTGTTCATATGTATCCCTCGTATCCCTATAGTAGAAATTACCAGCTTGACCTTAAT
TTCTATGATAGATCATGCCCCAATTTGCATAAGATTGTTGGATATGGTGTTTGGTTAGCCTTAAGAAATGACAACAGAATGGCCGCGTCCCTCCTTCGGTTGCACTTTCACGATTGCATA
GTAAAT
ATGTAAATTTTGTTACTTCTTACACTTCAAAATGAACAACGCACGTACTTAATTTGCATGGCTTTATATGTCTTTCTGTTAGACTCTAAATCATACTAGATCACACTAATTAGT
AGTTGTTGGCGGAATTTTCATAAATAGAAATCATAATTTTGATGATAGAAGCATGCTGTTAATTGATTGACACTAGAAATATAGTATTAGTTGAATACTTGAATGTGTTATAATTGGTCC
TCATCCACAAAAGTTTATTCCCACTACTTGGCCACTTTAGCCACTGGCTACCTTCCCAGTTCCTATATCTATATTTGTTTTATGAACATTAGGTAGACACAACACATTAAATCTAGAAAC
TTCCTTAGTTTTCCTTATTAATTCTATTAATAAGAACGGATCACATACGCATGCATAGATATAGATTTGAAATGGGTTACAGCGTACTGCTCATTCCATAAACAGATCAGACTACTTAAG
ATTTTCTAACTTCTAACATGTCTACAATTTTATTGTGGTGGAAATCTTTGTGTGTCTGGGGAGAAAAAGAGAAATGAAAGATGATAATAAAATATTGCAGGAAAGAAAAATGGAGTGAAA
AAAATAGCTGTATGATAAGGATAACCCATTTTTTTAACAGAATGATAAACTAGTTTTACATTCATTCAATCACAAATTATCGTTGATATGACTTTTGAGGTAATTATGTTAAAAATTGGT
AAACTTGCTATTTCTGATAGTTTGTGATCGAACAATTGCATATGTTAGTGCATTAGCCTTTCTTCTTTCACACTGTCTCTCCTAACCTTAGTTACACTGATATAGTGAAGGTTATATGTA
TTGTCTATTAAGTAGTAACCCTCTTCTTTATATTGTTTGCATTACATATGCAATTATCACATTTGGTATATATATGCCATGCCACTATAATCATAATAACATACACGGGGAAGAAACTAA
TTATGTTCAATTACTTGTCAAAGGGCTGTGATGCTTCTGTGCTTCTTGATGATACACCATATTTCACGGGCGAAAAGAATGCTCTTCCTAATCACAATTCACTTAGGGGGTTTGAAGTCA
TTGATGACATAAAAGAACATCTTGAAAGGATATGTCCATCAACAGTTTCCTGTGCTGATATATTGGCCTTAGCAGCTAGGGAAGCAATCGATCAG
AGGTAAAAGTGACACTTCCTTTAAA
TTATTGGACACAAGTTGTCGCAGCTGAAAGTTCCATAATTAAACAACAACCTATTTGATTTAGCCAACGTTGTTGTTATTGTTTCTTCTCCTACGTTTTGGGGGGTTTTAGATTGGAGGG
CCTTCTTGGCCTGTTCAATTAGGCCGAAGAGATGCAACAACAACCAGTAAGGAAGCAGCTGAGCAACAAATTCCCTCACCAATTGAGCCTCTAGAAAACATCACTGCAAAATTTTTCTCC
AAGGGTCTTGACATGAAGGATGTTGTAGCCCTTTCAG
AGGTTCTTATTCTTTTCTCACTCTTCTCTGACTTGATTTAGAATACACAAATACTACTAACTAGTGTCCTGAGAGCACTGGTT
AAGAAATAAAAAATACAGTTTCAATAAAAATTGTTATTAATATACATTTATCATGATTTCCAATGCATTCCAAATGTGAATTCTGTACACTGAGGATACTGGTTAGCATGACCATTTAGA
ATATATATCATTCTAATTTTAGGAAGTGAAAGAAGCTAACTAGGACTTTCACCAAATATTTGAGGCCTTTTCAGTACATGACATGAATAACTTGATGTGTCTATTTCCATCAGGAGCACA
TACAATTGGTTTTGCCCGATGCTTCACCTTCAAAAGGAGACTTTTTGACTTTCAAGGCTCTGGCAGACCTGATCCCGTGCTTGAATTTTCACTTCTATCAAAATTGCAAAACATGTGTCC
AAATGAAGACGCCTCAAACAGCAATCTAGCACCTCTTGATGCTACAAGTACCATGATGTTTGACAATGAGTATTATAGAAATATTGTATACAACACAGGACTTCTAGAATCTGACCAAGC
ACTAATTAAGGATCGAAGGACTGCTCCTACGGTTTATTATTACAGCAACAACCAATTTTCCTTCTACAATGATTTTGCCGAATCCATGGTGAAGCTTAGTAATGTAGGAGTACTTACAGG
AACAGAAGGGCAAATTAGATATAAATGTGGCTCTGTAAACTATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTTGTAGAATTGTGATCTACTTCACTTTCTTCTTCTGTTTGTTTTTTACCTCGGTTCCTCTTGTTCATATGTATCCCTCGTATCCCTATAGTAGAAATTACCAGCTTGACCTTAAT
TTCTATGATAGATCATGCCCCAATTTGCATAAGATTGTTGGATATGGTGTTTGGTTAGCCTTAAGAAATGACAACAGAATGGCCGCGTCCCTCCTTCGGTTGCACTTTCACGATTGCATA
GTAAAT
GGCTGTGATGCTTCTGTGCTTCTTGATGATACACCATATTTCACGGGCGAAAAGAATGCTCTTCCTAATCACAATTCACTTAGGGGGTTTGAAGTCATTGATGACATAAAAGAA
CATCTTGAAAGGATATGTCCATCAACAGTTTCCTGTGCTGATATATTGGCCTTAGCAGCTAGGGAAGCAATCGATCAG
ATTGGAGGGCCTTCTTGGCCTGTTCAATTAGGCCGAAGAGAT
GCAACAACAACCAGTAAGGAAGCAGCTGAGCAACAAATTCCCTCACCAATTGAGCCTCTAGAAAACATCACTGCAAAATTTTTCTCCAAGGGTCTTGACATGAAGGATGTTGTAGCCCTT
TCAG
GAGCACATACAATTGGTTTTGCCCGATGCTTCACCTTCAAAAGGAGACTTTTTGACTTTCAAGGCTCTGGCAGACCTGATCCCGTGCTTGAATTTTCACTTCTATCAAAATTGCAA
AACATGTGTCCAAATGAAGACGCCTCAAACAGCAATCTAGCACCTCTTGATGCTACAAGTACCATGATGTTTGACAATGAGTATTATAGAAATATTGTATACAACACAGGACTTCTAGAA
TCTGACCAAGCACTAATTAAGGATCGAAGGACTGCTCCTACGGTTTATTATTACAGCAACAACCAATTTTCCTTCTACAATGATTTTGCCGAATCCATGGTGAAGCTTAGTAATGTAGGA
GTACTTACAGGAACAGAAGGGCAAATTAGATATAAATGTGGCTCTGTAAACTATTAA

Retrieve as FASTA