Entry information : GmPrx172 (Glyma08g19340.1)
Entry ID 8971
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-26 (Christophe Dunand)
Peroxidase information: GmPrx172 (Glyma08g19340.1)
Name (synonym) GmPrx172 (Glyma08g19340.1)
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx172
start..stop
S start..stop
GmPrx03 626 0 1..324 1..323
LjPrx72 500 0 1..306 1..304
CclPrx116 486 6e-175 1..324 1..322
MtPrx21 475 2e-170 19..324 20..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14639681..14639884 204 N° 2 14639328..14639510 183 N° 3 14638878..14639040 163 N° 4 14636740..14637164 425
complement(join(14636740..14637164,14638878..14639040,14639328..14639510,1463968 1..14639884))


exon

Literature and cross-references GmPrx172 (Glyma08g19340.1)
DNA ref. Phytozome 12:   Gm08 (14639884..14636740)
Protein sequence: GmPrx172 (Glyma08g19340.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (303)
PWM (Da):   %s   35202.73 (32780.6)  
PI (pH):   %s   5.02 (5.17) Peptide Signal:   %s   cut: 22 range:22-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALFVLSLLFFSFLMGMSSEGQLEVGFYSNTCPQVDSIVGAVVRDAVLSDPNMAAVLLRLHFHDCFVQGCDGSILIENGPQSERHAFGHQGVRGFEVIERAKTKLEGSCPGLVSCADIVALAARDAVVMANGPAYQVPTGRRDGLVSNLSLADDMPDVSDSIELLKTKFLNKGLSVKDLVLLSGAHTIGTTACFFMTRRLYNFFPSGEGSDPAISQNFLPQLKARCPKNGDVNVRLAIDAWSEQKFDINILKNIREGFAVLESDARLNDDIATKNIIDSYFSPFSPMFGPSFEADFVESIVKMGQIGVKTGFLGEVRRVCSAFN*

Retrieve as FASTA  
Remarks Complete sequence from gonomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCTCTTTGTTTTGTCTCTCTTATTCTTCTCATTCTTAATGGGGATGAGTTCCGAGGGTCAGCTTGAAGTAGGTTTCTACTCCAACACATGTCCTCAAGTAGACTCAATTGTCGGT
GCCGTTGTTAGAGACGCTGTTCTCTCTGACCCCAACATGGCTGCTGTCTTACTCAGACTTCATTTTCACGATTGCTTTGTTCAG
GTAATTGAGGTCTATCTCTCTCTCTCTNNNNNNNNN
NNNNNNNNNNNNNNNNTGTTTTTATATATATACATGGGTATGTGTATACGTTGATGTTTCCTTTTCATCCTTAATTTTGGTTTTTATTCGGTGATATGATGTATATGTATTGGATCAATA
TTATTTCATTTCAGGGATGTGATGGTTCAATTCTGATTGAGAATGGTCCACAATCGGAGAGACATGCATTTGGACATCAAGGGGTTAGAGGGTTTGAAGTGATAGAAAGAGCCAAGACAA
AATTGGAAGGCTCTTGCCCCGGCTTGGTTTCTTGTGCAGACATAGTGGCTTTGGCAGCCAGAGACGCTGTAGTCATG
GTCCTTACCTAACTAACTTCATTATTAGTTAATTCATGCTTTT
TCTCTTCTTGCTCATATTTCTATACATCTTTAAAACAAAAAAAGAGTTATGTAAGATGCCTACACAAATATATATATGTTTATATGTTTGAAAAAGTGTTGAATGCATGGTTTTAAATAT
CAAAATATGTGCATCAGAAAATATCAAAATATCTTGATGTTGTGATCATAATTATGATTGCATGCGAACTGCCTTTTAAAACCATGGTTGGATGATATATTTTATTTTATGTACATGCAT
GCAGGCAAATGGGCCGGCATATCAAGTTCCAACAGGGAGGAGAGATGGGTTGGTTTCCAATCTTTCGCTTGCAGATGACATGCCAGATGTTAGTGATTCAATTGAGCTACTCAAGACCAA
GTTTCTCAACAAGGGTCTCTCCGTGAAAGACCTTGTTCTTCTTAGTG
GTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATGCTGAATAGGTGA
GATCATGGTTGTTGAGAAGGAAAGGTAATATGAACCTTGGCCAAAAGCAAAGAATATTATTTGACTTTAGACATGCAATAGCTAAATTACCAAACATATGCATATAACTTCTACACTCCG
CTTTAAAATACAATGAAAGCAAGTGAAGGAGTTCTGTACCCAATTTGGGAAATTGATGGTGAAGTCCTGAGAATTATTCGAGAAATTCTGATTATACAATAAATTTATATTACTTTTTAT
ACAAATAAGACAGAAGTAAGAAAAGAAGAAAGATAACGTGTAGATAGGATAAGTGTATTGAAAAAGACAGAAAAATAAATAAATAAATTATTGTATGAATTTGTTTTATGAATATGATCG
ATATCTTTTGTTTAAATATATGATATGATATATGAATGAGATCATCAAACTTTAACAATATCTCTTCCGCTTTTGACAATATTTCCGGATTCAATAAACGTTGACATAACAACTACCTTT
TTTTTTATTAATAAAATTATAAAGCAATAGGGGTCTTAGTACCTAGGATTCTGAACTGTGCCGTATGTTCCATTTATCCATTTAGGATAATGTTAGCTAAAAGGATCCATCTCATAGATG
TGTATATTAATTATTAATTTAATGATGCGTGTGAGAGAACTTTGATTTAATTCATGTCTTTCTATCAAATTCGATTAGTTGTATGTTGTTTACTAATAATGAAAGAATACGGTTGCTAAA
AAAATAAGTGGAGCATTTAATTTTACTAATAAAATATTGTAATTGTAACAATAGGCTGCCCTTTGAGCTGTATTTCTCTGTGTGCTAGCTAGAGCTAGCTTTCGTTTCATTGGTTTGGTT
TTACCTAATTCATCTGCCTAAAGTTTCGTATCAAACCGAACGCAAAATCGTGGCAGATGGCAGTTCTAATATTACACATGGTGCACATGCAACGTTACAGTTGTAATCCATATTAATTGA
TATTGATAGAGATCTTTGCTTGTTGTCTTTTTCTCTTATATTTACTATTTTATACTTTCTGATTACTTGAGAACCTATTTACTGGATTTCTGGGGAAATAGCTGGGTGATGCTCACGACA
GTGGCAAATATAAGCTAGAGTAATATGAGCAAGTAAAGAAAACGGACTCTTTTTCTGGTAAGCAAAGAAAATATAGTTAATGTTATTAACACATAGAGTGAGACAAACTCCAAAACATGA
AATCAATTAACGTGAGATTATTTAAATTTAATTAAATATTTTAAATTCAAGTCTTAGAAATATAATTATATTAATCATAATAATTTTATATCATTTAAATATGATATCTCTAACAAAGGA
TACAAGTACTATTAAAAAAAAACCGAGAAACAATAATTTGGTTTCTCAAATTGACAATACTAATAAATTAGTCTTTACTTAATATTATAAGAAGGAAAAAATTATTCATCAACTTTAAAT
AACTATAGAGTTAATTTTATTTTTTGTTAGCAATGTCTCACATGACTTGTCAATTATATCATGATCTACGTGACAACCCACTTAATGTGTCACGTGAAGTATACTATTAGACTAAAGTGG
TGATGATGATTATGAAAGTTTAGGATTATTTACTTGTTTGTAATATGGTAATATTTTATTCATTTTTAAAATAATTTTAGGTGCGCATACAATTGGAACCACAGCGTGTTTCTTTATGAC
CAGAAGACTGTACAACTTTTTCCCAAGTGGTGAGGGGTCAGACCCAGCAATTAGCCAAAACTTCCTCCCTCAGCTAAAGGCAAGGTGCCCTAAGAATGGAGATGTTAATGTTCGTCTAGC
TATTGATGCATGGAGTGAGCAGAAGTTTGACATAAACATTTTGAAGAACATAAGGGAAGGTTTTGCTGTGCTAGAATCTGATGCCAGACTCAATGATGACATAGCCACCAAGAATATCAT
TGACTCCTATTTTTCTCCCTTCAGTCCAATGTTTGGACCTTCTTTTGAAGCTGATTTTGTTGAGTCAATTGTGAAAATGGGCCAAATTGGTGTCAAGACAGGTTTCCTTGGAGAGGTTAG
GCGCGTGTGTTCAGCTTTTAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCTCTTTGTTTTGTCTCTCTTATTCTTCTCATTCTTAATGGGGATGAGTTCCGAGGGTCAGCTTGAAGTAGGTTTCTACTCCAACACATGTCCTCAAGTAGACTCAATTGTCGGT
GCCGTTGTTAGAGACGCTGTTCTCTCTGACCCCAACATGGCTGCTGTCTTACTCAGACTTCATTTTCACGATTGCTTTGTTCAG
GGATGTGATGGTTCAATTCTGATTGAGAATGGTCCA
CAATCGGAGAGACATGCATTTGGACATCAAGGGGTTAGAGGGTTTGAAGTGATAGAAAGAGCCAAGACAAAATTGGAAGGCTCTTGCCCCGGCTTGGTTTCTTGTGCAGACATAGTGGCT
TTGGCAGCCAGAGACGCTGTAGTCATG
GCAAATGGGCCGGCATATCAAGTTCCAACAGGGAGGAGAGATGGGTTGGTTTCCAATCTTTCGCTTGCAGATGACATGCCAGATGTTAGTGAT
TCAATTGAGCTACTCAAGACCAAGTTTCTCAACAAGGGTCTCTCCGTGAAAGACCTTGTTCTTCTTAGTG
GTGCGCATACAATTGGAACCACAGCGTGTTTCTTTATGACCAGAAGACTG
TACAACTTTTTCCCAAGTGGTGAGGGGTCAGACCCAGCAATTAGCCAAAACTTCCTCCCTCAGCTAAAGGCAAGGTGCCCTAAGAATGGAGATGTTAATGTTCGTCTAGCTATTGATGCA
TGGAGTGAGCAGAAGTTTGACATAAACATTTTGAAGAACATAAGGGAAGGTTTTGCTGTGCTAGAATCTGATGCCAGACTCAATGATGACATAGCCACCAAGAATATCATTGACTCCTAT
TTTTCTCCCTTCAGTCCAATGTTTGGACCTTCTTTTGAAGCTGATTTTGTTGAGTCAATTGTGAAAATGGGCCAAATTGGTGTCAAGACAGGTTTCCTTGGAGAGGTTAGGCGCGTGTGT
TCAGCTTTTAATTGA

Retrieve as FASTA