1. Browse the Database
  2. View Redoxidase
Entry information : GmPrx172 (Glyma08g19340.1)
Entry ID 8971
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-26 (Christophe Dunand)
Peroxidase information: GmPrx172 (Glyma08g19340.1)
Name (synonym) GmPrx172 (Glyma08g19340.1)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx172
start..stop		 S start..stop
GmPrx03 626 0 1..324 1..323
LjPrx72 500 0 1..306 1..304
CclPrx116 486 6.69e-175 1..324 1..322
MtPrx21 475 2.05e-170 19..324 20..323
Gene structure Fichier Exons►


exon

Literature and cross-references GmPrx172 (Glyma08g19340.1)
DNA ref. Phytozome 12:   Gm08 (14639884..14636740)
Protein sequence: GmPrx172 (Glyma08g19340.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (303)
PWM (Da):   %s   35202.73 (32780.6)  
PI (pH):   %s   5.02 (5.17) Peptide Signal:   %s   cut: 22 range:22-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALFVLSLLFFSFLMGMSSEGQLEVGFYSNTCPQVDSIVGAVVRDAVLSDPNMAAVLLRLHFHDCFVQGCDGSILIENGPQSERHAFGHQGVRGFEVIERAKTKLEGSCPGLVSCADIVA
LAARDAVVMANGPAYQVPTGRRDGLVSNLSLADDMPDVSDSIELLKTKFLNKGLSVKDLVLLSGAHTIGTTACFFMTRRLYNFFPSGEGSDPAISQNFLPQLKARCPKNGDVNVRLAIDA
WSEQKFDINILKNIREGFAVLESDARLNDDIATKNIIDSYFSPFSPMFGPSFEADFVESIVKMGQIGVKTGFLGEVRRVCSAFN*

Retrieve as FASTA  
Remarks Complete sequence from gonomic (3 introns).
DNA ►
Send to BLAST
CDS►
Send to BLAST