Entry information : GmPrx189 (Glyma09g42130.1)
Entry ID 8978
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-26 (Christophe Dunand)
Peroxidase information: GmPrx189 (Glyma09g42130.1)
Name (synonym) GmPrx189 (Glyma09g42130.1)
Class Class III peroxidase    [Orthogroup: Prx187]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx189
start..stop
S start..stop
GmPrx195 636 0 1..328 1..328
GmPrx312 536 0 1..328 1..329
GmPrx190 513 0 1..328 1..329
MtPrx50 482 4e-173 28..328 30..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46756975..46757190 216 N° 2 46756132..46756902 771  
complement(join(46756132..46756902,46756975..46757190))


exon

Literature and cross-references GmPrx189 (Glyma09g42130.1)
DNA ref. Phytozome 12:   Gm09 (46757190..46756132)
Protein sequence: GmPrx189 (Glyma09g42130.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (303)
PWM (Da):   %s   34972.2 (32279.9)  
PI (pH):   %s   5.37 (5.62) Peptide Signal:   %s   cut: 26 range:26-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDNTSMLQMVSSLVLILSVSSLASASLKVGFYSSTCPSAEEIVRSTVNKAISDKAGIAAGLIRMHFHDCFVRGCDGSVLLASTPGNPVAERDNFANNPSLRGFEVIEEAKTQLEAACPQTVSCADILAFAARDSALKVGGINYDVPSGRRDGRISIADEVPRNLPAPTSTADELVSNFSRKGLSADEMVTLSGAHSIGVSHCSAFSKRLYSFNDTVTQDPSMDSSYAETLKSICPAPPSTTDSTVSLDPSTPIRLDNKYYEGLINHRGLLTSDQTLHTSQTTREMVQSNANNGASWAEKFAKAMVQMGSIEVLTGSDGEIRRHCSLVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATAATACTAGCATGCTTCAAATGGTTTCAAGCTTGGTTCTGATTCTAAGTGTTTCATCATTGGCTTCGGCATCTCTGAAAGTGGGTTTCTACAGCTCCACGTGCCCATCTGCCGAG
GAAATAGTGAGAAGCACAGTAAACAAAGCAATTTCAGACAAGGCCGGCATAGCTGCGGGTCTCATAAGAATGCATTTCCATGATTGCTTTGTCAGG
GTAGGTTCACTTTCCTACAACCAT
GTTAAAATTATTATTTCTGATTGCAAATTAACTGCTATGTATATACAGGGTTGCGATGGTTCCGTGTTACTAGCATCTACCCCAGGTAACCCAGTAGCCGAGAGAGACAATTTTGCCAAC
AATCCAAGCTTACGTGGCTTCGAGGTGATTGAGGAGGCCAAGACCCAATTAGAGGCTGCATGCCCTCAAACGGTATCGTGTGCAGACATTTTGGCATTCGCAGCAAGAGACAGTGCTCTC
AAAGTTGGTGGCATAAACTACGACGTACCATCTGGACGCCGAGACGGACGCATCTCCATTGCTGATGAAGTGCCACGGAATCTGCCTGCGCCAACCTCCACTGCCGATGAACTTGTTAGT
AATTTTTCTCGAAAGGGCTTGTCAGCAGATGAAATGGTGACACTTTCTGGAGCGCATTCAATTGGTGTGTCGCATTGTTCTGCCTTCTCCAAGCGCTTGTACTCTTTCAATGACACAGTC
ACACAAGATCCCTCTATGGACTCTTCATATGCTGAAACGTTGAAAAGCATTTGTCCTGCACCTCCTTCCACCACAGATTCTACAGTGTCTCTTGATCCTTCCACACCCATTCGTTTGGAC
AACAAATACTATGAGGGATTGATCAACCACCGTGGCCTCTTGACATCAGATCAGACGTTGCACACCAGTCAAACCACAAGGGAAATGGTTCAAAGCAATGCCAACAATGGTGCAAGTTGG
GCTGAGAAGTTTGCCAAGGCAATGGTGCAAATGGGTTCCATCGAAGTGCTTACGGGATCCGATGGTGAGATAAGGAGACATTGCAGCCTTGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATAATACTAGCATGCTTCAAATGGTTTCAAGCTTGGTTCTGATTCTAAGTGTTTCATCATTGGCTTCGGCATCTCTGAAAGTGGGTTTCTACAGCTCCACGTGCCCATCTGCCGAG
GAAATAGTGAGAAGCACAGTAAACAAAGCAATTTCAGACAAGGCCGGCATAGCTGCGGGTCTCATAAGAATGCATTTCCATGATTGCTTTGTCAGG
GGTTGCGATGGTTCCGTGTTACTA
GCATCTACCCCAGGTAACCCAGTAGCCGAGAGAGACAATTTTGCCAACAATCCAAGCTTACGTGGCTTCGAGGTGATTGAGGAGGCCAAGACCCAATTAGAGGCTGCATGCCCTCAAACG
GTATCGTGTGCAGACATTTTGGCATTCGCAGCAAGAGACAGTGCTCTCAAAGTTGGTGGCATAAACTACGACGTACCATCTGGACGCCGAGACGGACGCATCTCCATTGCTGATGAAGTG
CCACGGAATCTGCCTGCGCCAACCTCCACTGCCGATGAACTTGTTAGTAATTTTTCTCGAAAGGGCTTGTCAGCAGATGAAATGGTGACACTTTCTGGAGCGCATTCAATTGGTGTGTCG
CATTGTTCTGCCTTCTCCAAGCGCTTGTACTCTTTCAATGACACAGTCACACAAGATCCCTCTATGGACTCTTCATATGCTGAAACGTTGAAAAGCATTTGTCCTGCACCTCCTTCCACC
ACAGATTCTACAGTGTCTCTTGATCCTTCCACACCCATTCGTTTGGACAACAAATACTATGAGGGATTGATCAACCACCGTGGCCTCTTGACATCAGATCAGACGTTGCACACCAGTCAA
ACCACAAGGGAAATGGTTCAAAGCAATGCCAACAATGGTGCAAGTTGGGCTGAGAAGTTTGCCAAGGCAATGGTGCAAATGGGTTCCATCGAAGTGCTTACGGGATCCGATGGTGAGATA
AGGAGACATTGCAGCCTTGTTAATTAA

Retrieve as FASTA