Entry information : GmPrx190 (Glyma09g42160.1)
Entry ID 8979
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-26 (Christophe Dunand)
Peroxidase information: GmPrx190 (Glyma09g42160.1)
Name (synonym) GmPrx190 (Glyma09g42160.1)
Class Class III peroxidase    [Orthogroup: Prx187]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx190
start..stop
S start..stop
GmPrx312 573 0 1..329 1..329
GmPrx189 533 0 1..329 1..328
GmPrx195 533 0 1..329 1..328
MtPrx50 460 2e-164 29..329 30..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46775890..46776108 219 N° 2 46774820..46775590 771  
complement(join(46774820..46775590,46775890..46776108))


exon

Literature and cross-references GmPrx190 (Glyma09g42160.1)
DNA ref. Phytozome 12:   Gm09 (46776108..46774820)
Protein sequence: GmPrx190 (Glyma09g42160.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (303)
PWM (Da):   %s   34805.24 (31980.7)  
PI (pH):   %s   5.02 (5.00) Peptide Signal:   %s   cut: 27 range:27-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDNTPRLLQSVSSLILILSISSLASASLKVGFYSSTCPSAEAIVRSAVEKAISANPGIAAGLIRMHFHDCFVRGCDGSVLLASRPGNPISERDNLVNNPSLRGFEVIEEAKNQIEDACPQTVSCADILAFAARDSVSKVGGINYDVPSGRRDGGVSIGGEVIGNLPGPSFSADELVSSFSRKGLSADEMVTLSGAHSIGVSHCGSFSNRLYSFSDTATQDPSLDSSYAETLKGKCPPPPPTSDPTVSLEPSTPIRLDSKYYEALINHRGLLTSDQTLYTSQSTRAMVESNAYNAASWAEKFALAMVRMGSIEVLTGSDGEIRKQCSFVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATAATACTCCCAGATTGCTTCAATCGGTTTCAAGCTTGATTCTGATTCTAAGCATTTCATCATTGGCCTCAGCATCTCTGAAAGTGGGTTTCTATAGCTCAACGTGTCCATCTGCT
GAGGCAATAGTGAGAAGCGCAGTAGAGAAAGCAATATCTGCCAACCCAGGCATAGCTGCTGGTCTCATCAGAATGCATTTCCATGATTGCTTTGTCAGG
GTAAGTTACTAAGGATATGGT
TGGATAAACTTCTGCAGAAACACGTTTAATGGAAGAAATAAATAAAATGATTGAATTTCTTCATGAACTAAAATTAGATTATAAACAAACTAATTTGTAGAGATTTTCCTATATATATAT
ATAACTTCTTTAAAAGATGATTTTTAACTTATGCATAAGTGGTTCTCGATGAGCTTATTGAAACAGACCCAAATTTCACCTTCATACTTTCCTATATATACATGCATGTTTAATAAAAAC
ATTTCAATATCGGATTCTAAAATTGTTATCTTCCACAGGGTTGTGATGGTTCTGTGTTACTAGCATCTAGACCGGGTAATCCAATATCCGAAAGAGACAATTTGGTTAACAACCCAAGCT
TGCGTGGCTTCGAGGTGATTGAGGAAGCCAAAAATCAAATAGAGGATGCATGTCCTCAAACAGTATCATGTGCAGACATATTGGCATTCGCAGCACGAGACAGTGTTTCGAAGGTTGGTG
GCATAAACTACGACGTTCCATCCGGACGCAGAGATGGTGGCGTCTCAATCGGCGGTGAAGTGATAGGCAATCTTCCAGGACCATCCTTCAGTGCTGATGAACTTGTTAGTAGTTTTTCTC
GAAAGGGGTTGTCAGCAGATGAAATGGTGACACTCTCAGGAGCGCATTCAATCGGTGTATCCCATTGTGGCTCCTTCTCAAATCGCTTATACTCTTTCAGTGACACAGCTACACAAGATC
CCTCATTGGACTCTTCATATGCTGAAACGTTGAAAGGAAAGTGTCCCCCACCACCCCCCACCTCAGACCCAACAGTGTCTCTTGAACCTTCCACGCCTATTCGTTTGGACAGTAAATACT
ATGAGGCATTAATCAACCACCGTGGCTTGTTGACGTCGGATCAGACGTTGTACACGAGCCAATCCACAAGGGCAATGGTTGAAAGCAACGCATACAATGCTGCAAGTTGGGCTGAGAAAT
TTGCCCTAGCAATGGTGCGCATGGGTTCTATAGAAGTGCTTACTGGCTCCGATGGTGAGATCAGGAAGCAGTGCAGCTTTGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATAATACTCCCAGATTGCTTCAATCGGTTTCAAGCTTGATTCTGATTCTAAGCATTTCATCATTGGCCTCAGCATCTCTGAAAGTGGGTTTCTATAGCTCAACGTGTCCATCTGCT
GAGGCAATAGTGAGAAGCGCAGTAGAGAAAGCAATATCTGCCAACCCAGGCATAGCTGCTGGTCTCATCAGAATGCATTTCCATGATTGCTTTGTCAGG
GGTTGTGATGGTTCTGTGTTA
CTAGCATCTAGACCGGGTAATCCAATATCCGAAAGAGACAATTTGGTTAACAACCCAAGCTTGCGTGGCTTCGAGGTGATTGAGGAAGCCAAAAATCAAATAGAGGATGCATGTCCTCAA
ACAGTATCATGTGCAGACATATTGGCATTCGCAGCACGAGACAGTGTTTCGAAGGTTGGTGGCATAAACTACGACGTTCCATCCGGACGCAGAGATGGTGGCGTCTCAATCGGCGGTGAA
GTGATAGGCAATCTTCCAGGACCATCCTTCAGTGCTGATGAACTTGTTAGTAGTTTTTCTCGAAAGGGGTTGTCAGCAGATGAAATGGTGACACTCTCAGGAGCGCATTCAATCGGTGTA
TCCCATTGTGGCTCCTTCTCAAATCGCTTATACTCTTTCAGTGACACAGCTACACAAGATCCCTCATTGGACTCTTCATATGCTGAAACGTTGAAAGGAAAGTGTCCCCCACCACCCCCC
ACCTCAGACCCAACAGTGTCTCTTGAACCTTCCACGCCTATTCGTTTGGACAGTAAATACTATGAGGCATTAATCAACCACCGTGGCTTGTTGACGTCGGATCAGACGTTGTACACGAGC
CAATCCACAAGGGCAATGGTTGAAAGCAACGCATACAATGCTGCAAGTTGGGCTGAGAAATTTGCCCTAGCAATGGTGCGCATGGGTTCTATAGAAGTGCTTACTGGCTCCGATGGTGAG
ATCAGGAAGCAGTGCAGCTTTGTTAATTAA

Retrieve as FASTA