Entry information : GmPrx[P]162
Entry ID 8987
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-12-02 (Qiang Li)
Peroxidase information: GmPrx[P]162
Name GmPrx[P]162
Class Class III peroxidase     [Orthogroup: Prx003]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]162
start..stop
S start..stop
GmPrx162 277 5e-94 83..232 176..325
GmPrx162 135 2e-38 1..110 1..118
PvPrx12 256 1e-85 83..232 176..325
PvPrx12 137 2e-39 1..82 1..80
GmPrx10 252 5e-84 83..232 176..324
GmPrx10 147 2e-43 1..110 1..118
MtPrx53 248 1e-82 83..231 178..326
MtPrx53 128 5e-36 1..82 3..82
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8836670..8836883 214 N° 2 8836984..8837012 29 N° 3 8837102..8837142 41 N° 4 8838441..8838853 413
join(8836670..8836883,8836984..8837012,8837102..8837142,8838441..8838853)


exon

Literature and cross-references GmPrx[P]162
DNA ref. Phytozome 12:   Gm12 (8836670..8838853)
Protein sequence: GmPrx[P]162
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   232 (209)
PWM (Da):   %s   25476.03 (23169.8)  
PI (pH):   %s   8.56 (8.39) Peptide Signal:   %s   cut: 24 range:24-232
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSQSYFKALIIxLIALIGSTQAQLQLGFYAKSCPKAEKIILKYVVEHSRNAPSLAVALIRMHFRDCFVNVCGCDGSVLVNSNVGLDVNDLVLLSGAQTIGVSHCPSIVTRLYNFTGKGDTDPTLDNEYAKNLKTFKCKNINDNTTLIEMDPGSCDTFDLGYYKQVVKRMGLFQSDVSLLESSNTRAIIIRQLQSTQGFFAEFAKSMEKMGRINVKIETKGEIRKHCTQINS

Retrieve as FASTA  
Remarks Partial or pseudogene sequence from genomic (exons 2 and 3 are missing due to "n"). No prediction from phytozome. No EST. join(8836670..8836883,8836984..8837012,8837102..8837142,8838441..8838853)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAGCCAGAGTTACTTCAAGGCTTTGATTATTTNNCTTATAGCACTAATTGGATCAACTCAAGCTCAGTTGCAGCTTGGTTTCTATGCCAAAAGTTGTCCAAAGGCTGAGAAAATA
ATTTTGAAGTATGTTGTTGAGCATAGCCGCAATGCTCCATCACTAGCAGTTGCTCTCATAAGAATGCACTTCCGTGATTGTTTTGTCAATGTAT
GTAGATAATTTATGTTTCATTTTCTA
GTCAATGGCTATTTAATTTGTTAAACTGAGGAGGTAAGAATGTAACATTAATATCTAGTACATATATTAATTTCAGGGTTGTGATGGATCAGTGCTTGTGAACTCAAAATGTAAAATAAT
TTCCAGCAAAACTAGGAAAACGTACTGACTGGAGTAATTTCTGGCAATCAGTGAGTCAGTAGTAAAAGTAAAAGGAATGTTGGACTTGATGTAAACGACCTTGTCTTGCTTTCTGGTATG
TCAAATACTAAGTTTTGTAATAAAAATTAGGTTTAAACATGTTTTTAAAATTTAAAATTAATCTTTTTAATGTTTGAGAAAAATTGTTTTAGTACCTCCCTCAAAACATCCTATGCCCAA
ACGCAAATGAATACATTTTAAGGAAAACACACATGTAGCCAGTTGTTTGACAATTAGAATGCAAAATCAAAGTGGATTGTCAAGTAAGTGACTTATAATTCAATAGCTACAAGTGAAATC
TTTAACGACATTTGGATGAATGGATTAAAATGGATCCTTTTCAAATTATAAGAATAAAATGATCAATTTTAAATTTGGAAGACAAAAAATAAATTATCATATTTAAAAAACTAAAAATAT
ATTTAAGCTTAAAAATTTACATTAAAGGAACATAAGTTACCAAGGTGAAACTCTAATTTTGATCGGATAACAATATCAAAATCATGCAAAAAAAAACTATATGTAAGTTTTATCATTTCC
TTTGTTACACATTTTAAATTCTTCGATTCTAATCACCAAAGATTCAATTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNATAGAAGAACCTTTCAAAACGTTCGCGTATTTCCTTTATAACCTTCATCCTCTCTTCCACCTGAAAGTTTCCAAAATTTCGTTCTCGAACTCGTGACTCTTCTC
TCACGCCGAGGAGCCTCTTCTTCAAGAAACACCGTCTGAACTCGTAGAGCATCAATTGGGTGCGAGCGTAGTGGATACGTAGAACTGCACCCGCTAGTTAGGGGAGCAGCTGTCGCTGCC
CATCATATGGCGGAGGTGCTCGCCGGCGTGGAGGGCCTTGGCCATGCCTTGCGTCGTTGATTGAATGTTGTGGTCGGGTGTGGTGGTGTACGCCGCCATGTCCTGGTTTCCCTGCGACTC
CCCATGCCGCATCAATATTCTTCTCTTTGGAAGCACACCAACCATATATTCTTTTCTCTTTGCATTCATTTTTTTTCACCCTGACAATTTTAATTTTTTTTTTATCAAAACATAAAATTT
TGAAAATAAAAGAATTTCAATTAAAATATTTAAAATTCTTAGAATTTTAAATTTCTCATAATTTTAAATTCCTTCATCCAAACACACCCTTAGGTGCTCAGACGATTGGTGTTTCCCATT
GCCCATCAATTGTAACCCGTTTATATAATTTCACTGGCAAGGGTGACACTGACCCGACTCTAGACAATGAATATGCAAAAAATCTTAAGACCTTTAAGTGCAAGAATATCAATGACAACA
CCACACTTATTGAGATGGACCCCGGAAGTTGTGACACATTTGATCTTGGCTATTATAAACAAGTGGTTAAGAGAATGGGCTTGTTCCAATCAGATGTTTCATTGCTTGAAAGCTCTAACA
CAAGGGCTATTATCATCAGACAACTTCAATCAACTCAAGGATTCTTTGCAGAATTTGCCAAGTCCATGGAGAAAATGGGACGAATTAATGTCAAGATCGAAACAAAAGGAGAGATACGGA
AACATTGTACACAAATAAATAGCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAGCCAGAGTTACTTCAAGGCTTTGATTATTTNNCTTATAGCACTAATTGGATCAACTCAAGCTCAGTTGCAGCTTGGTTTCTATGCCAAAAGTTGTCCAAAGGCTGAGAAAATA
ATTTTGAAGTATGTTGTTGAGCATAGCCGCAATGCTCCATCACTAGCAGTTGCTCTCATAAGAATGCACTTCCGTGATTGTTTTGTCAATGTAT
AGGGTTGTGATGGATCAGTGCTTGTG
AAC
AGGAATGTTGGACTTGATGTAAACGACCTTGTCTTGCTTTCAGGTGCTCAGACGATTGGTGTTTCCCATTGCCCATCAATTGTAACCCGTTTATATAATTTCACTGGCAAGGGTGAC
ACTGACCCGACTCTAGACAATGAATATGCAAAAAATCTTAAGACCTTTAAGTGCAAGAATATCAATGACAACACCACACTTATTGAGATGGACCCCGGAAGTTGTGACACATTTGATCTT
GGCTATTATAAACAAGTGGTTAAGAGAATGGGCTTGTTCCAATCAGATGTTTCATTGCTTGAAAGCTCTAACACAAGGGCTATTATCATCAGACAACTTCAATCAACTCAAGGATTCTTT
GCAGAATTTGCCAAGTCCATGGAGAAAATGGGACGAATTAATGTCAAGATCGAAACAAAAGGAGAGATACGGAAACATTGTACACAAATAAATAGCT

Retrieve as FASTA