Entry information : GmPrx231 (Glyma12g37060.1)
Entry ID 8991
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2014-04-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-04-10 (Christophe Dunand)
Peroxidase information: GmPrx231 (Glyma12g37060.1)
Name (synonym) GmPrx231 (Glyma12g37060.1)
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Globular embryos
Immature seeds
Seeds
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx231
start..stop
S start..stop
GmPrx48 652 0 1..339 3..342
PvPrx17 577 0 16..339 21..345
MtPrx94 557 0 20..339 96..413
LjPrx33 553 0 19..339 28..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 40032888..40033094 207 N° 2 40033162..40033353 192 N° 3 40035408..40036028 621  
join(40032888..40033094,40033162..40033353,40035408..40036028)


exon

Literature and cross-references GmPrx231 (Glyma12g37060.1)
DNA ref. Phytozome 12:   Gm12 (40032888..40036028)
Protein sequence: GmPrx231 (Glyma12g37060.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339 (318)
PWM (Da):   %s   37962.01 (35544.8)  
PI (pH):   %s   7.72 (7.70) Peptide Signal:   %s   cut: 22 range:22-339
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTMAMPLFLMFLLLHIAWVASSDLRPGFYSKTCPKAELIVRDVMKKALMREPRSVASVMRFQFHDCFVNGCDGSMLLDDTPTMLGEKLALSNINSLRSYEVVDQVKEALEKDCPGVVSCADIIIMASRDAVSLTGGPEWEVRLGRLDSLSANQEDSNNIMPSPRANASSLIDLFQKYNLTVKDLVALSGSHSIGQGRCFSVMFRLYNQSGTGRPDPAIDPSYRQYLNRLCPLDVDQNVTGNLDSTPLVFDNQYFKDLAARRGFLNSDQTLFTFPHTREFVRLFSRRKTEFFKAFVEGMLKMGDLQSGRPGEVRTNCRLVNARPINLLLQSPHNMESNDK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2) and 234 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTTGTATGT TTCTTTTACT AAAAAAACTA TTTTATAGAG AGTACTATAA AAAAAATAAT TGTTCTCAAC AAAGGTTATT GAAGTCAAAA CTTTGATATA TCTTTAAACT TCAAAAGTTG  GATATTCTTT TACAGAAAAA GCCAATGGAA AGAGATTTTT TAGAAAGTAA TCTTTTCACC TTTTTTATAC TGTCGGAAAG AAAAAAAAAA CATAAAATAC CGTGTGAAAC CCATTACTTT  ATAGATATGT TCAATTTAGA TTAAAAACGG TTGAAAGCTT GTCTTTGTGT TAATAAAATA TCAATTTACC TTTATTTTTA CAAACTTTAT TTTTTAATTA GGAATATTTA TGTTATTGTA  CAAGACATTT TTCTTTCTTT TTTCTTTTTA CATAAATAAC CAAGATAAAA GAAAAATTTT ATAATTTTTA TTTGAGTACA TAGTTACTTT TGTCCCTAAA TGTATAATTT ACTAACAAAT  GCATTCCTGA AAAATAAAAA TACAAAATTT AATCTTTAAA AGTATAAAAG TGTGATAAAT ATATTTGGTC ATTAACTTTT GTTCGTCATC GTTAATAAAA TAATCTATGT GGCATAGAGG  AACGACTTTA TCATCTCTAA TTGTTAACAT ATGGACATAA TAGTCACATA TAATATTTTT TTGATTTTTC GTCTTCCCAC TCTTAATAAT GTAAATAGTC ACTTTTGTTC TTGAATGTGT  AATTCGCTGA CAAATACGTT CCTAAAAGAT AAAAATATAA AATTTAGTCC CAAAAAATGT ACAAAGTGCG ACAAATATAT CCAAAAGTTA ACTTTTGTCC ATCACCGTTG ATAAAATAGT  CAAGATTCGA AGAAGTGAAA TATGAAATAT ATTTATCTTT TATTTATAAT AGATTGTGAC TAATTATTAT AATTTGAAAA AATTTGTAAT GGTTGGTATA TTGTTACAAT ATTTATTTTG  AATAATTTCT ATTGTGATAG ATAAATTATG ATTGATAATC AATATTATCG TTATTATTAT ATTTATTTGA AATTATGTTT GGCAATATAT TTTTATAAGT GATTATTTTA ATATTATGCT  TGTAACGATA AAAAATGATA AAAATTTATC TTAAAATTAT ATTTTACCCT TAATAATAAT TTATTGACAT TTTGGTCATA TAAGATGTAT TGACATTTAG GTTCAAAACA AAATTATTGA  CATTTTCCTC CCATAAAAAA CATTAACATT TTTGTCGAAT AAAAAATGAT TGACATTTAT GTGCAAGAAT GATATCTTAC TAATATTTTC GTCCAATCTA GTCTCATGAC CACATTAACA  ATCATTTTAG TGATAAATTC GTCTCTTTAT GTCACATAAA TTATTTTATT AACAGTAACA GACGAAATTT GACAATCGAA TATATTTATT ACATTTTTTA TATTTTTGAG AAATAAATTT  CATATTTTCT TTAAGAAGAT ATTTATCAGC GATTTACAAA TTCAAAAATA AATGTGAGTA TTTATGCTTT TTATTTTTTA TTTTCTCTCC TACTTGCAAG CTAAAACTTG TCACTTTTTC  TTTCCTTTTC TTCCTTTTGA TGTACTTTTT TCCCCGAAAA CAAACGCATC CTACTAGTGT TTCCCAACAA GAAAAGGACT AAATTGCAAA AATAATAAGA TACCGACTCT TCCAGAAAAA  ACGCATCCTG CAACATGATT TGGACACGGG TTTTGGATCT GTCTGGCCAT GACCCATGAG TCATGAGAGG GAAGCAAAAG CCTTAAATTA AATGGGCAAG TTGCAAAAAA AATATTTATC  ATTTCATTCC TATAAAGTGA GTAATCGTGT CCTGTCAGTA GATATTCCAA AAATGATTTT TCATTAAAAT TAAAAACAAT TACTTTATCC TCCTCCAAAC TCCAAAGTGA GTAACCATAT 
ATAGCCACCC TCTCTCCTCC GATCACTCTC CACTCCAGTG TGGAAAATCA AAACAAGGTG CCATCTTTGT TTGTTATAC 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCATGGCCATGCCCCTGTTTCTGATGTTCCTTCTTCTGCACATAGCTTGGGTGGCATCGTCGGATCTCCGACCTGGGTTTTACTCAAAAACATGTCCAAAAGCGGAACTCATAGTC
CGAGATGTGATGAAGAAGGCCCTTATGAGGGAACCCAGAAGTGTTGCCTCTGTTATGCGCTTCCAGTTCCATGATTGCTTTGTCAAC
GTACGTACTAGTAATTTGATTTTATTTAGTATC
TTTAATTTAATTTTACTTTTACTCTTTTGTGAAGGGGTGTGATGGTTCTATGTTGCTTGATGATACACCAACGATGCTGGGGGAGAAATTGGCCCTCTCAAATATAAATTCGCTGAGATC
GTATGAAGTTGTCGATCAAGTGAAGGAAGCGCTCGAGAAGGACTGCCCCGGAGTGGTTTCCTGTGCTGACATCATAATTATGGCATCTAGAGATGCTGTCTCTCTG
GTTCCTTCCTTCCT
TCAATTTCTTTTCTTCTCACCCTAAATTGCACTCTCTCTATCTCCACCACTAAATAATTTCTAAATTAGCTATTTTAATTTAATCATACTTAGAAAATACATGACAACTTTATCATACAT
TTTAAGTACAATATTAAGTAAATTTACACTGTTATAAAGGTTAATAAATTTGTCTTACAAACGCGTAAGTAGAAGAAAGTACTGCTATAAAAAAAACCTTTTATATTATTAATATATTTT
AATTAAATTATTTGTTTAAACTTAATAATACTGTGCAACATATATAAAAATAAAATAATTTTTTTATATGAAGCTTGGAATGCAAAAGGACAGTAGCAATAGGCTAGTCACCCCAACTAT
TTTGACACCCCTAGACTACCACTCAGCACCTCGAATAACATTAAAATAAAAGAGAGAAAAAACCAACAAAGCACGGAGGAATTAGACCAAAACTCATAATAACTAATAACCAAGAAATGG
GTTAGCAAAACCTACAACTAGGTATATGATCTGTTCTGAAAGAAGTCTTCCAAAATAAAAGACGGATCAAGATCCCACACCAACTAAAAAGAGAACACGAGTTAGCCCCAAAATTAGCCA
ACTTGCCTGCGTAAGAATCTCCTAAAATTAAAAAATTCCTACCTAGCTTAATAAGTATCTTAAGTATTTTGTGAAGAAAACATGAAATGAAAAATTAAATGTATTTCTTACTTTTCAAAA
AGTTTAGTAAAAATAATATATTACTTTAAGACAATATAGAATTATTTCCATAATTACTATTTCCATTTATTTTTATTTTTCTACCTTTAAAAGAAAAAATATACAATGTATTATAGGTTA
GACCAAAATAAATAATAGAGATGATATTAGGACGTTAAAATTAATTTTAACATAAACGAGGATATATATTACAGTTTTTAATCTATGTAAAAAAAATATTCTAAATGAATAGTAGATAAT
AAGAATGGCAGTAAAAAAAGTAGATAATAAGAATGGAAAGTATATGCAGGTTAAATGCAGTTTCATATTTATTTAAAGTGTATCTGATACTATTTTAAATCATATATTAATGCCATGTAG
TAGTAGCATTCTTCGGTTTCTTTTCATATGTAATTTTGTGTAATTGCACAAGGATTAAGTAAACAATTAATGAGTCAACCAGGTCCACTGCACATGTATTATGGCAAATTTGAACGAAAT
TCAATTTTAAATACCACTTTTTTCCCCTTAGAATTTAATGTGATGTAATGTTAGCGCAAATGTTTGTACGAGCATTTATTGTGGTGTTACTGCATCATTAAATGGATTAATTATTAACAT
ATTAAATGCATTGACAGTTTAATTTTTTAAAACATTAACAACTCATTATAATTAAATCAATTTATATTTGAGATTGTTAAGTGGTCTTCTTTATTTGGGGATTCTGAATTTGGAATTAAG
CCTTTTGATTATTTCTCATTTTAACAACTAATTCATAATTAAGAATGGAGGAATGCTGTTGTACTCTCTCTCTCGAAAATTCTATATTTGATTAGAATTTATTAGAAAATATTAATTTTG
GTAGGTTTTACTTTTCATTTAATATAAATTAAGAGAGAATTATTAAATGAGAAACAAAACATAATAAAAAACATAATAAAAATAGTGATTTCTAATAAATTTTAACCAATATAGAGTTTT
AGAAAGAGAATGTCATAAGCATTTTTCTTAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATTTTGAAGAAGTGAAAACGCAGTGATACCTTGAGTATTTTCTT
CTCAATACATGTTTTCTAAATCTTAAAAAATTAAAATGAATTTTTTTCAGAAAATAAAAAAAAAAAAAAAGCCTTTTGGTGGTAATTCTATATGCTAAATGTTTTTTACTTGCATTGCAG

ACAGGTGGACCTGAGTGGGAGGTGAGGTTGGGAAGATTGGACAGCTTGAGTGCTAATCAAGAAGACTCAAACAACATCATGCCAAGCCCAAGAGCCAACGCAAGCTCTCTTATTGATCTC
TTCCAGAAATATAACCTTACTGTGAAAGACCTAGTAGCACTCTCAGGATCTCACTCTATTGGCCAAGGTCGTTGTTTCTCCGTCATGTTTAGGCTATACAATCAATCTGGAACTGGAAGG
CCTGACCCTGCCATTGACCCTAGCTATAGACAATACCTTAACAGGCTATGTCCACTGGATGTTGACCAAAATGTCACAGGGAACCTTGATTCCACGCCTCTCGTCTTTGATAACCAATAT
TTCAAGGACTTGGCTGCTAGGAGGGGCTTTCTCAATTCTGATCAAACACTCTTCACATTCCCCCACACAAGGGAGTTTGTGAGGTTATTTAGTAGACGCAAAACTGAGTTTTTCAAGGCA
TTTGTGGAAGGAATGTTGAAAATGGGTGACTTGCAGTCTGGTCGACCTGGGGAAGTTAGGACTAACTGCAGGCTCGTCAATGCTCGCCCGATTAATTTGCTGCTTCAGTCTCCACACAAC
ATGGAGAGTAACGATAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCATGGCCATGCCCCTGTTTCTGATGTTCCTTCTTCTGCACATAGCTTGGGTGGCATCGTCGGATCTCCGACCTGGGTTTTACTCAAAAACATGTCCAAAAGCGGAACTCATAGTC
CGAGATGTGATGAAGAAGGCCCTTATGAGGGAACCCAGAAGTGTTGCCTCTGTTATGCGCTTCCAGTTCCATGATTGCTTTGTCAAC
GGGTGTGATGGTTCTATGTTGCTTGATGATACA
CCAACGATGCTGGGGGAGAAATTGGCCCTCTCAAATATAAATTCGCTGAGATCGTATGAAGTTGTCGATCAAGTGAAGGAAGCGCTCGAGAAGGACTGCCCCGGAGTGGTTTCCTGTGCT
GACATCATAATTATGGCATCTAGAGATGCTGTCTCTCTG
ACAGGTGGACCTGAGTGGGAGGTGAGGTTGGGAAGATTGGACAGCTTGAGTGCTAATCAAGAAGACTCAAACAACATCATG
CCAAGCCCAAGAGCCAACGCAAGCTCTCTTATTGATCTCTTCCAGAAATATAACCTTACTGTGAAAGACCTAGTAGCACTCTCAGGATCTCACTCTATTGGCCAAGGTCGTTGTTTCTCC
GTCATGTTTAGGCTATACAATCAATCTGGAACTGGAAGGCCTGACCCTGCCATTGACCCTAGCTATAGACAATACCTTAACAGGCTATGTCCACTGGATGTTGACCAAAATGTCACAGGG
AACCTTGATTCCACGCCTCTCGTCTTTGATAACCAATATTTCAAGGACTTGGCTGCTAGGAGGGGCTTTCTCAATTCTGATCAAACACTCTTCACATTCCCCCACACAAGGGAGTTTGTG
AGGTTATTTAGTAGACGCAAAACTGAGTTTTTCAAGGCATTTGTGGAAGGAATGTTGAAAATGGGTGACTTGCAGTCTGGTCGACCTGGGGAAGTTAGGACTAACTGCAGGCTCGTCAAT
GCTCGCCCGATTAATTTGCTGCTTCAGTCTCCACACAACATGGAGAGTAACGATAAATAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CGGCCGGGGA CTCCAGTGTG GAAAATCAAA ACAAGGTGCC ATCTTTGTTT GTTATACATG ACCATGGCCA TGCCCCTGTT TCTGATGTTC CTTCTTCTGC ACATAGCTTG GGTGGCATCG  TCGGATCTCC GACCTGGGTT TTACTCAAAA ACATGTCCAA AAGCGGAACT CATAGTCCGA GATGTGATGA AGAAGGCCCT TATGAGGGAA CCCAGAAGTG TTGCCTCTGT TATGCGCTTC  CAGTTCCATG ATTGCTTTGT CAACGGGTGT GATGGTTCTA TGTTGCTTGA TGATACACCA ACGATGCTGG GGGAGAAATT GGCCCTCTCA AATATAAATT CGCTGAGATC GTATGAAGTT  GTCGATCAAG TGAAGGAAGC GCTCGAGAAG GACTGCCCCG GAGTGGTTTC CTGTGCTGAC ATCATAATTA TGGCATCTAG AGATGCTGTC TCTCTGACAG GTGGACCTGA GTGGGAGGTG  AGGTTGGGAA GATTGGACAG CTTGAGTGCT AATCAAGAAG ACTCAAACAA CATCATGCCA AGCCCAAGAG CCAACGCAAG CTCTCTTATT GATCTCTTCC AGAAATATAA CCTTACTGTG  AAAGACCTAG TAGCACTCTC AGGATCTCAC TCTATTGGCC AAGGTCGTTG TTTCTCCGTC ATGTTTAGGC TATACAATCA ATCTGGAACT GGAAGGCCTG ACCCTGCCAT TGACCCTAGC  TATAGACAAT ACCTTAACAG GCTATGTCCA CTGGATGTTG ACCAAAATGT CACAGGGAAC CTTGATTCCA CGCCTCTCGT CTTTGATAAC CAATATTTCA AGGACTTGGC TGCTAGGAGG  GGCTTTCTCA ATTCTGATCA AACACTCTTC ACATTCCCCC ACACAAGGGA GTTTGTGAGG TTATTTAGTA GACGCAAAAC TGAGTTTTTC AAGGCATTTG TGGAAGGAAT GTTGAAAATG  GGTGACTTGC AGTCTGGTCG ACCTGGGGAA GTTAGGACTA ACTGCAGGCT CGTCAATGCT CGCCCGATTA ATTTGCTGCT TCAGTCTCCA CACAACATGG AGAGTAACGA TAAATAAATA  AAAAATAAAT GCGTGTCTCT TCATATTATA TGTTATCCAA ATATGAAACG AAATATTTTC ACTTCCAAAT TCAAATGTTT AAGAGTGTTA TCAAAAGAAT CGTATTTGAA AAATTAAATG  CAGCCTATTT CACTTCTAAA TTCTTCTTCC AAACATGTAA AAATTACATA AGTCCTCGAG TTACAACCAA AAGCTGAAAG TCAACTTCAA CAGTTATAAA AACAAAGTCT CTGCCTCTTA  GGCATTTCAG TTCTCCGATA TGATAGCTAA CGAGCAAGAT AGAGGTAGAG ATCGTTTCTT CACCCACAAA CAATTTCTAT TATGCTAGTC GTACATAGTG GAATTCAGAT CCTTGGTACA  GAAGTTACTT CATGACAGCC TTTATTATTT TCAACCCAGT CACAGTAATC AGGACTTTTC TGAATACACT TTGCCTGATG CCCTAAGAAT GAAGTATGAT GCGAGGACAA AAAATCAAAA  ATATTAATCC AAATTTTGCA AAATCACTAT AGACTAAGCA ACATACAACA AAACCTTTAC AAAGAGTAGC CGTCCCTTAA AACATGTTGC CTGGCAAGAT TTTTTGAAAT CTCCCTTCAC  AAGCACTCAA CACAGGATGT TGCATAAAAT GTACAATCTC AACAGTAACT CACCCTAATA CATGAACAAC AATAGATGCA AGCTATCACA ACAAATCCAA AAGGGGTGGC TGCTCAGCAT 
GTGACTTGGT ATGAGAGGAC CGAGTGGTTG AAGCAGCTCC CCTCCCTCTT CCTCGTCCTC TACCCACAGT GGTTGAAGGG GGTGGTGCAA GTTTAGGTGC AATTTGTTCA TTCC 

Retrieve as FASTA