1. Browse the Database
  2. View Redoxidase
Entry information : GmPrx235 (Glyma13g16590.1)
Entry ID 8994
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-11-28 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-16 (Christophe Dunand)
Peroxidase information: GmPrx235 (Glyma13g16590.1)
Name (synonym) GmPrx235 (Glyma13g16590.1)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx235
start..stop		 S start..stop
GmPrx76 633 0 1..330 1..330
GmPrx288 615 0 1..331 1..333
MtPrx09 552 0 1..330 1..330
LjPrx26 549 0 10..330 13..333
Gene structure Fichier Exons►


exon

Literature and cross-references GmPrx235 (Glyma13g16590.1)
DNA ref. Phytozome 12:   Gm13 (20514559..20511992)
Protein sequence: GmPrx235 (Glyma13g16590.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (301)
PWM (Da):   %s   35533.51 (32074.8)  
PI (pH):   %s   6.02 (4.95) Peptide Signal:   %s   cut: 30 range:30-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKRPFSSSGYHFCLMNMFLLLLAVRSQLTTDFYKSSCPNVSKIVRREVQKALMNEIRMAASLLRLHFHDCFVNGCDGSILLDGGDDGEKSAAPNLNSARGYEVVDTIKSSVESACSGVVS
CADILAIAARDSVFLSGGPSWKVLLGRRDGTVSNGTLANEALPSPFDPLDTIISKFTNMGLNLTDVVSLSGAHTIGRARCTLFGNRLFNFSGTGAPDSTLDTDMLSDLQSLCPQNGDGNV
TTVLDRNSSDLFDSHYFKNLLSGMGLLSSDQILFSSDEANSTTKPLVQSYSNDSGLFFGDFANSMIKMGNINIKTGTNGEIRKNCRVINS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA ►
Send to BLAST
CDS►
Send to BLAST