1. Browse the Database
  2. View Redoxidase
Entry information : GmPrx238 (Glyma13g24110.1)
Entry ID 8997
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-11-28 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-16 (Christophe Dunand)
Peroxidase information: GmPrx238 (Glyma13g24110.1)
Name (synonym) GmPrx238 (Glyma13g24110.1)
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx238
start..stop		 S start..stop
VuPrx02 603 0 13..349 1..336
MtPrx74 593 0 8..349 4..346
RcPrx49 535 0 13..348 16..352
MePrx10 532 0 13..348 18..347
Gene structure Fichier Exons►


exon

Literature and cross-references GmPrx238 (Glyma13g24110.1)
DNA ref. Phytozome 12:   Gm13 (27436506..27440891)
Protein sequence: GmPrx238 (Glyma13g24110.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (316)
PWM (Da):   %s   38419.74 (34717.0) Transmb domain:   %s   i13-35o
PI (pH):   %s   9.57 (9.66) Peptide Signal:   %s   cut: 34 range:34-349
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLPSFATTSFSFLFTSFFVFFILCGNSSSSLAIHANTTRPPRQLSVSYYAKSCPQVEQLVGSVTSQQFKESPVSGPATIRLLFHDCFVGGCDASILIASKPGSKELAEKDAEDNRDLKV
EAFETVRKAKEQVERKCPGVVSCADILVIAARDYVHLAGGPYYQVKKGRWDGKISTASRVASNIPHANSTVDQLIKLFTSKGLTTQDLVALSGAHTIGFAHCKNFVARLYSYRGKAQPDP
NMDPKLLHVLRMYCPNFGGNSDIVAPFDATTPFLFDHAYYGNLQKKLGLLASDQTLALDPRTKPIVEDLAKDKQKFFKAFVGAMDKLSLVKVVRGKRHGEKRRDCSMHM*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA ►
Send to BLAST
CDS►
Send to BLAST