Entry information : GmPrx249 (Glyma14g38150.1)
Entry ID 9000
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2015-12-16 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-12-16 (Achraf Jemmat)
Peroxidase information: GmPrx249 (Glyma14g38150.1)
Name (synonym) GmPrx249 (Glyma14g38150.1)
Class Class III peroxidase    [Orthogroup: Prx188]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx249
start..stop
S start..stop
GmPrx74 619 0 1..319 1..320
GmPrx330 517 0 1..319 1..320
GmPrx63 509 0 1..319 1..320
CclPrx113 477 1e-171 5..319 3..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 47382945..47383160 216 N° 2 47384164..47384355 192 N° 3 47385002..47385167 166 N° 4 47385328..47385713 386
join(47382945..47383160,47384164..47384355,47385002..47385167,47385328..47385713 )


exon

Literature and cross-references GmPrx249 (Glyma14g38150.1)
DNA ref. Phytozome 12:   Gm14 (47382945..47385713)
Protein sequence: GmPrx249 (Glyma14g38150.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (294)
PWM (Da):   %s   33899.61 (30944.3)  
PI (pH):   %s   7.91 (7.68) Peptide Signal:   %s   cut: 26 range:26-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFHSRGHMFSFSTIFLCMFSMASSQLTSNCYESTCPQALSIIRTVVIGAVAKDHRMGASLLRLHFHDCFVNGCDASVLLDNTSTFTGEKSAGANVNSLRGFEVIDDIKTKVEAACPGVVSCADILAIAARDSVVALGGPSWNVGLGRRDSTTASKDSATTDIPSPLMDLSALISSFSKKGFNTKEMVALSGAHTTGQARCQLFRGRVYNESSIESNFATSLKSNCPSTGGDSNLSPLDVTTSVLFDTAYFKNLINKKGLLHSDQQLFSGGSTDSQVTAYSNDPSAFYADFASAMVKMGNLSPLTGKSGQIRTNCRKVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTTCACTCCCGTGGTCACATGTTTTCTTTCTCCACCATTTTTCTTTGCATGTTTTCCATGGCCTCTTCTCAGTTAACTTCAAATTGCTATGAATCAACATGCCCTCAAGCCCTC
TCTATCATCAGAACCGTGGTGATCGGAGCAGTTGCCAAAGACCACCGTATGGGAGCTTCCTTGCTCCGTCTTCATTTTCATGACTGCTTTGTCAAT
GCACGTTTTCTCTTCCTTCCTAGC
CTCATTAATTTTTCTGATCATTTTCAATTAATCTCATGCATATATATAGGATTAAATTCGATCCGAAAAAATATATATACTAGCATGATCGGCATGCATTTACTCTGCTTTTCAAAATGT
ACTTAGAGAAGCCTACACATTTTATTAGTTTTGTTTTTGTATACAAAGGTCGCATTGAAATTTAAATCTATAACCTCTTACATACTAGTGGTTGTGCATTTAGTTTTGTTTAAAGTCATG
AGGGATTTATTTTAGAAACAAAAATAAGACATACATCAATCTTTAATGAGAAAATCATGAAAATAGATTTTAATATAATTTGATTTATCTAATTTGTATCTGTTTAGAATATCTAGAATT
GATTTTCCCATTGTTAGGATTGTTTAAAATTCTATTTAGGAAGGCTTATAGTTTTGGCAAACCTTTATACAAAATTACCGTTCTTATCCTTTTATACTTGGGCATTTTTTCCCATAAACT
ATATATCATGCATTTTTTTCGTCATATATATGTGTGTGTACGTGTAAGCACTCATGCATCATGCATGATTCTTGTTTTCGTGGTCTAACCTAACATGCATGCGCATCCGGTCCTTGTAAG
TATGATCGAGTGTGAATTTTAAATTCAAACTGCTTTTTGAGAGTGGAAGAAAAAAAAAACATTGTTTGGCGTGGTAGTTGAAAGTTAATTGAATTTAATTATAGCACGCATGAAAATAAA
AGTTGACATATATCCACGTTCAGTTTAACCAAATAATATTCTCATATACCTTCCTAGCTACATCGTTTTGCCAAATTAATTAACTTAAGCTTTTAGATTAGTTAGAAATATTTCTTTAAA
TCTTAGAGGATGTCATGAAAATATAGCTAATTAAGCGTTTAATGCAGATTAGAAGAATGAGACATATTAAAATAACTGCATTTTTAACTTTTTGGATATTAGTAATTAATGTGTTACGTG
ATACAAATTTGTATTGTAGGGATGTGATGCATCTGTTCTGTTAGATAACACTTCGACCTTTACTGGAGAGAAGTCAGCTGGTGCAAATGTGAATTCTCTGAGAGGTTTTGAAGTAATTGA
TGACATCAAAACTAAAGTGGAGGCTGCTTGTCCCGGAGTTGTTTCTTGTGCAGATATTCTAGCTATTGCTGCCCGTGATTCCGTTGTTGCA
GTAAGTTTAGTAAATATGAACAAATAAAA
TCCAAAATGATAAACATATTGATATATAGATATACTTGTTGGCTTGTTACACTATTATTATAGAACATGTCTCGTTATAAAATTTGATAAAGTTTCACCTACTCGTATTATAAACCAGAT
GTACAAGAATTATAAATTTTTACAAAACTATTGTTTTTCTCTCTTCATCTCATTATCTATATATCTTATCTCACACATTTCTCTCTTCTCTTCCTATTTAGAAAGTGTGTTGTGAGAATT
TTGGTAATCTCATTATCTATATATCTTACACTTTTCTCTCTTCTCTTCCTATTTAGAAAGTGTGTTGTCAGAATTTAGGTAAGTAAAAATAGTATTACATACATGATTTTTTATTTAACA
CTTTCATTTAAAAAAGACATATTAATTTGAGCTTGAAGAGTAAATGATTCTAATAATCATTTCAGCTATTATTTAGAATGATGAGGGTGACAAGGACAGAAATTCAGACCACAAGGCCGT
TATAGTAGTTTTAAAAATACTACTATCATAAACTAATTACTCCAAGAGCTTAAAATAGTAGGTAAAATTACATAAAACAGTGTTATATCTAACAATTCACTTTTTAACAATTGAGTGGTA
TTTTGGTTTTATCTCAGTTGGGAGGACCATCATGGAATGTTGGGTTAGGCAGAAGAGATTCAACCACGGCAAGTAAAGATTCTGCCACTACGGATATCCCATCCCCACTAATGGATCTTA
GTGCCCTTATATCTTCTTTTTCAAAAAAGGGGTTTAACACCAAGGAAATGGTAGCCCTCTCAG
GTAAATAAATATTAGAGGATCTCTCATAATAATCTCTAACTTTGACTTTAACTAATT
AATTAATGGCATTAATATAAATAAGATTATATATTATGTCAACAATATATATTATCACACATATGAATCTTGAATCATTTAATAATTTTTCATGCATAAATAGGAGCACATACAACGGGG
CAAGCCAGGTGTCAGCTATTCAGAGGCAGGGTTTACAATGAAAGCAGCATTGAGTCAAACTTTGCAACATCACTCAAGTCAAACTGTCCAAGCACTGGTGGAGACAGCAACCTTTCCCCG
CTTGATGTTACCACAAGTGTTCTATTTGACACTGCTTATTTCAAGAACCTCATCAACAAAAAGGGACTTCTACATTCTGATCAGCAATTATTTAGTGGTGGTTCAACAGATTCTCAGGTC
ACTGCCTATAGCAACGACCCTTCAGCTTTCTATGCAGACTTTGCTAGTGCCATGGTCAAAATGGGAAACCTTAGCCCCTTAACAGGGAAAAGTGGCCAAATTCGTACTAATTGCCGCAAG
GTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTTCACTCCCGTGGTCACATGTTTTCTTTCTCCACCATTTTTCTTTGCATGTTTTCCATGGCCTCTTCTCAGTTAACTTCAAATTGCTATGAATCAACATGCCCTCAAGCCCTC
TCTATCATCAGAACCGTGGTGATCGGAGCAGTTGCCAAAGACCACCGTATGGGAGCTTCCTTGCTCCGTCTTCATTTTCATGACTGCTTTGTCAAT
GGATGTGATGCATCTGTTCTGTTA
GATAACACTTCGACCTTTACTGGAGAGAAGTCAGCTGGTGCAAATGTGAATTCTCTGAGAGGTTTTGAAGTAATTGATGACATCAAAACTAAAGTGGAGGCTGCTTGTCCCGGAGTTGTT
TCTTGTGCAGATATTCTAGCTATTGCTGCCCGTGATTCCGTTGTTGCA
TTGGGAGGACCATCATGGAATGTTGGGTTAGGCAGAAGAGATTCAACCACGGCAAGTAAAGATTCTGCCACT
ACGGATATCCCATCCCCACTAATGGATCTTAGTGCCCTTATATCTTCTTTTTCAAAAAAGGGGTTTAACACCAAGGAAATGGTAGCCCTCTCAG
GAGCACATACAACGGGGCAAGCCAGG
TGTCAGCTATTCAGAGGCAGGGTTTACAATGAAAGCAGCATTGAGTCAAACTTTGCAACATCACTCAAGTCAAACTGTCCAAGCACTGGTGGAGACAGCAACCTTTCCCCGCTTGATGTT
ACCACAAGTGTTCTATTTGACACTGCTTATTTCAAGAACCTCATCAACAAAAAGGGACTTCTACATTCTGATCAGCAATTATTTAGTGGTGGTTCAACAGATTCTCAGGTCACTGCCTAT
AGCAACGACCCTTCAGCTTTCTATGCAGACTTTGCTAGTGCCATGGTCAAAATGGGAAACCTTAGCCCCTTAACAGGGAAAAGTGGCCAAATTCGTACTAATTGCCGCAAGGTTAATTAA

Retrieve as FASTA