Entry information : GmPrx254 (Glyma15g03250.1)
Entry ID 9002
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-11-28 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-16 (Christophe Dunand)
Peroxidase information: GmPrx254 (Glyma15g03250.1)
Name (synonym) GmPrx254 (Glyma15g03250.1)
Class Class III peroxidase    [Orthogroup: Prx028]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx254
start..stop
S start..stop
GmPrx28 669 0 1..338 1..338
MtPrx60 522 0 1..334 1..336
LjPrx22 511 0 1..334 1..334
PpePrx77 471 3e-168 7..334 12..342
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2256128..2256367 240 N° 2 2255867..2256049 183 N° 3 2255626..2255785 160 N° 4 2254945..2255378 434
complement(join(2254945..2255378,2255626..2255785,2255867..2256049,2256128..2256 367))


exon

Literature and cross-references GmPrx254 (Glyma15g03250.1)
DNA ref. Phytozome 12:   Gm15 (2256367..2254945)
Protein sequence: GmPrx254 (Glyma15g03250.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339 (312)
PWM (Da):   %s   37685.81 (34857.5)  
PI (pH):   %s   8.51 (8.66) Peptide Signal:   %s   cut: 27 range:27-338
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRVMCVAFPLVALVVVSMCYGMADAEVKTQNLRWHYYKVTNTCRDAEEYVRHQVNLFWKNDRSITAKLLRLVYADCFVTGCDASILLDEGANPEKKAAQNRGLGGFAAIDKIKTVLESRCPGIVSCADILHLATRDAVKLAGGPGYPVLTGRKDGMKSDAASVDLPSPSVLQQKVLEYFKSRNLNEVDMTTLLGAHTMGRTHCSFIVDRLYNYNGSGKPDPSMSATFLESLRKLCPPRKKGQADPLVYLNPESGSSYNFTESYYGRILSHETVLGVDQQLLYSDDTKQISEEFAVGFEDFRKSFATSMYKMGNYRVLTGNQGEIRRYCRYTNKGNPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Containing motif 'YADC'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAGAGTTATGTGTGTGGCCTTCCCGCTAGTAGCTCTTGTAGTGGTGAGCATGTGTTATGGAATGGCAGATGCAGAGGTGAAAACACAAAATTTGCGCTGGCATTATTACAAGGTC
ACCAATACATGCCGTGATGCAGAGGAGTATGTCCGGCACCAAGTGAACCTGTTTTGGAAGAATGACAGAAGCATTACGGCAAAGCTCCTCCGCTTGGTTTATGCTGACTGTTTTGTCACT
GTATGTACTATAGTTTCTAGTTAGTGTTAGTTGGTGTTTTGTGACTTACCTTTCAGCAAACAATATTTTGTGGCCTAGGGATGTGATGCATCAATTCTGCTTGACGAAGGAGCAAATCCG
GAGAAAAAAGCAGCACAAAACCGGGGGCTTGGAGGATTTGCAGCCATTGACAAGATCAAAACTGTTCTGGAATCACGATGCCCTGGAATTGTCTCATGTGCTGATATACTCCACCTGGCC
ACCAGGGATGCTGTTAAACTG
GTACTTCTAGGCTACTTTCAACTCCTTCTACCACTAGCCCCTCCATATCAAACTAACTTATTTGAGGATTGATGGGAACAGGCAGGTGGACCAGGTTAC
CCAGTTTTAACAGGTAGGAAGGATGGCATGAAATCAGATGCTGCATCAGTAGACCTGCCATCACCATCCGTCTTGCAGCAGAAAGTCCTGGAATATTTCAAATCCAGGAACTTGAATGAA
GTAGACATGACCACTCTTTTAG
GTAAGGCGGCAAACTTACAATCCAGATGTAAATATAAAAATATGTTAAGAATTTTATATATTTTATAGTTTATTATAAATAATTTATTGTAAATTGTG
TTTTAAGATAATGCATTTATTTTTATGAAAACTAAGCATGTTAAAAATATTTGTTCAAATCTCTTTTATATATATAGAATGTTTCTGGTTAAGGCACCCATGTAAGCAATAAAAATAACG
TTTCTAAAATTTGTTGGACATCAACACAGGAGCACACACGATGGGCCGAACACATTGTAGCTTTATTGTTGACCGGCTCTATAACTACAATGGTTCCGGAAAACCGGACCCGAGCATGAG
TGCTACTTTTCTAGAGTCATTGAGAAAACTTTGTCCGCCAAGAAAGAAAGGACAAGCAGACCCTCTGGTATACCTAAACCCAGAATCAGGATCAAGTTACAACTTCACAGAATCATACTA
CGGAAGGATCCTATCCCACGAAACTGTCCTGGGAGTTGATCAACAATTACTATATAGTGATGACACTAAACAGATCTCCGAGGAGTTCGCCGTTGGATTTGAAGATTTTCGGAAATCTTT
TGCTACATCAATGTACAAGATGGGGAATTACAGGGTTCTAACAGGAAACCAAGGAGAGATACGCCGATATTGCCGATACACAAATAAGGGCAACCCAAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAGAGTTATGTGTGTGGCCTTCCCGCTAGTAGCTCTTGTAGTGGTGAGCATGTGTTATGGAATGGCAGATGCAGAGGTGAAAACACAAAATTTGCGCTGGCATTATTACAAGGTC
ACCAATACATGCCGTGATGCAGAGGAGTATGTCCGGCACCAAGTGAACCTGTTTTGGAAGAATGACAGAAGCATTACGGCAAAGCTCCTCCGCTTGGTTTATGCTGACTGTTTTGTCACT
GGATGTGATGCATCAATTCTGCTTGACGAAGGAGCAAATCCGGAGAAAAAAGCAGCACAAAACCGGGGGCTTGGAGGATTTGCAGCCATTGACAAGATCAAAACTGTTCTGGAATCACGA
TGCCCTGGAATTGTCTCATGTGCTGATATACTCCACCTGGCCACCAGGGATGCTGTTAAACTG
GCAGGTGGACCAGGTTACCCAGTTTTAACAGGTAGGAAGGATGGCATGAAATCAGAT
GCTGCATCAGTAGACCTGCCATCACCATCCGTCTTGCAGCAGAAAGTCCTGGAATATTTCAAATCCAGGAACTTGAATGAAGTAGACATGACCACTCTTTTAG
GAGCACACACGATGGGC
CGAACACATTGTAGCTTTATTGTTGACCGGCTCTATAACTACAATGGTTCCGGAAAACCGGACCCGAGCATGAGTGCTACTTTTCTAGAGTCATTGAGAAAACTTTGTCCGCCAAGAAAG
AAAGGACAAGCAGACCCTCTGGTATACCTAAACCCAGAATCAGGATCAAGTTACAACTTCACAGAATCATACTACGGAAGGATCCTATCCCACGAAACTGTCCTGGGAGTTGATCAACAA
TTACTATATAGTGATGACACTAAACAGATCTCCGAGGAGTTCGCCGTTGGATTTGAAGATTTTCGGAAATCTTTTGCTACATCAATGTACAAGATGGGGAATTACAGGGTTCTAACAGGA
AACCAAGGAGAGATACGCCGATATTGCCGATACACAAATAAGGGCAACCCAAATTAG

Retrieve as FASTA