Entry information : GmPrx256 (Glyma15g05810.1)
Entry ID 9003
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-11-28 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-16 (Christophe Dunand)
Peroxidase information: GmPrx256 (Glyma15g05810.1)
Name (synonym) GmPrx256 (Glyma15g05810.1)
Class Class III peroxidase    [Orthogroup: Prx007]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx256
start..stop
S start..stop
GmPrx05 553 0 1..322 1..325
GmPrx170 546 0 1..322 1..325
LjPrx07 533 0 1..322 1..326
LjPrx23 526 0 1..322 1..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4125791..4126186 396 N° 2 4125415..4125577 163 N° 3 4124462..4124871 410  
complement(join(4124462..4124871,4125415..4125577,4125791..4126186))


exon

Literature and cross-references GmPrx256 (Glyma15g05810.1)
DNA ref. Phytozome 12:   Gm15 (4126186..4124462)
Protein sequence: GmPrx256 (Glyma15g05810.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (298)
PWM (Da):   %s   34564.46 (31895.0) Transmb domain:   %s   i5-27o
PI (pH):   %s   8.21 (8.40) Peptide Signal:   %s   cut: 25 range:25-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEGQSLYSLVFLVLALAIVNTVHGQGTRVGFYSSTCPRAEFIVRSTVQSHVRSDPTLAAGLLRMHFHDCFVQGCDASVLIAGDGTERTAFANLGLRGFEVIDNAKTQLEAACPGVVSCADILALAARDSVSLSGGPNWQVPTGRRDGRISQASDVSNLPAPFDSVDVQKQKFAAKGLNTQDLVTLVGGHSIGTTACQFFSNRLYNFTANGPDSSINPLFLSQLRALCPQNSGGSNRVALDTGSQTRFDTSYFANLRIGRGILQSDQALWNDPSTKSFVQRYLGGFKGLLFNVEFAKSMVKMSNIELKTGTDGEIRKICSAIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 2 and 3).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGGACAGAGTTTGTACTCACTAGTGTTTCTTGTGCTTGCTCTGGCCATTGTGAACACAGTGCATGGGCAAGGGACGCGTGTAGGGTTCTATTCGAGTACATGCCCACGGGCTGAG
TTCATTGTTAGGTCCACAGTTCAATCCCACGTTAGGTCTGATCCTACCTTGGCTGCTGGGTTGCTTCGGATGCACTTCCATGATTGCTTTGTGCAAGGTTGCGATGCTTCTGTTCTCATT
GCCGGTGATGGAACTGAGAGAACAGCATTTGCAAACCTTGGTTTACGAGGATTTGAGGTTATTGATAATGCAAAGACACAGCTCGAGGCTGCGTGCCCCGGTGTTGTGTCTTGTGCTGAT
ATCCTTGCTCTTGCAGCTCGTGATTCCGTTTCTCTG
GTAGTACTTAACTCAAAATCTATCAATGTTTGAATTTATGTAATGTTGCAAATAATTAATCTCATAATATATATGTCTTTGTTA
GCAAAGTGCAAGACATTTAGATTCACTAGTTGAATCAATTGCCAAGTTGAGTTCAATTAATTAATTAATATATTTGTATACATGTAATGAGGTTATAACTAAAATTTGGCTTATTAATTT
GCATGGCAGAGTGGTGGACCGAATTGGCAAGTGCCTACTGGACGCAGAGATGGACGCATATCACAGGCTTCCGATGTGAGTAACTTGCCTGCTCCTTTTGACTCTGTTGATGTTCAGAAA
CAAAAGTTCGCAGCAAAGGGTCTCAACACTCAAGACCTCGTCACCCTTGTCG
GTAATAACTTTATACAATCACATGCACATATAAGTTTGTTTACACACTTCAAATCAATGAATTGATCA
TCATTACTACAATTTCAATTTAGTAGATATAAGATTCACCAAGAGTTCATCACTTCGAATTTCTTAATTAATAAAACTAACAAATTGATACTTGATCATAAAAAAAATTCGATTTTGCTT
TGTGACAAGTGAGGTTCTAACTACGTAGTGGCAAAATGCTAATAGAATCACTATATGTAAACTGTATTGTTGACTTTTTCACGTCACTTTTCTTATATTGTCATTAGGAAACGTCTTTTT
TGGGTCTTATTTTTTTCCCATTTTCAAGTGATTAATTGGATATTTTTATAGGGTGTTTTAAAAAATTAAAAGACGTTTTTCAACGGGTATACAAAAAACTGAAAAATTCTAAGCACTCAA
ATTTACTCGAACTTTATCTTCTATGTACGAAAAGAAAAAATCATGTGAAACTAAGGTACGAGTAGTTAACGATAGAGTTGAAATAACTAATTTATTTTGGTGAATACATGTGTAGGTGGG
CATAGCATTGGTACTACAGCATGCCAATTCTTCAGTAATAGATTATACAACTTCACTGCAAATGGTCCTGACTCTTCCATCAACCCTTTATTTCTTTCTCAACTTAGAGCACTCTGCCCA
CAAAATAGTGGCGGTTCAAACCGAGTGGCTCTTGATACGGGTAGTCAAACCAGATTTGACACATCTTACTTTGCTAATTTGAGGATTGGCCGTGGAATTCTGCAGTCTGATCAAGCACTT
TGGAATGATCCTTCCACGAAGTCATTTGTACAGAGGTACCTGGGCGGCTTCAAAGGCTTGCTTTTCAACGTGGAATTTGCAAAGTCTATGGTGAAGATGAGCAACATTGAGTTGAAGACC
GGTACTGATGGTGAAATTCGCAAGATATGTTCTGCCATTAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGGACAGAGTTTGTACTCACTAGTGTTTCTTGTGCTTGCTCTGGCCATTGTGAACACAGTGCATGGGCAAGGGACGCGTGTAGGGTTCTATTCGAGTACATGCCCACGGGCTGAG
TTCATTGTTAGGTCCACAGTTCAATCCCACGTTAGGTCTGATCCTACCTTGGCTGCTGGGTTGCTTCGGATGCACTTCCATGATTGCTTTGTGCAAGGTTGCGATGCTTCTGTTCTCATT
GCCGGTGATGGAACTGAGAGAACAGCATTTGCAAACCTTGGTTTACGAGGATTTGAGGTTATTGATAATGCAAAGACACAGCTCGAGGCTGCGTGCCCCGGTGTTGTGTCTTGTGCTGAT
ATCCTTGCTCTTGCAGCTCGTGATTCCGTTTCTCTG
AGTGGTGGACCGAATTGGCAAGTGCCTACTGGACGCAGAGATGGACGCATATCACAGGCTTCCGATGTGAGTAACTTGCCTGCT
CCTTTTGACTCTGTTGATGTTCAGAAACAAAAGTTCGCAGCAAAGGGTCTCAACACTCAAGACCTCGTCACCCTTGTCG
GTGGGCATAGCATTGGTACTACAGCATGCCAATTCTTCAGT
AATAGATTATACAACTTCACTGCAAATGGTCCTGACTCTTCCATCAACCCTTTATTTCTTTCTCAACTTAGAGCACTCTGCCCACAAAATAGTGGCGGTTCAAACCGAGTGGCTCTTGAT
ACGGGTAGTCAAACCAGATTTGACACATCTTACTTTGCTAATTTGAGGATTGGCCGTGGAATTCTGCAGTCTGATCAAGCACTTTGGAATGATCCTTCCACGAAGTCATTTGTACAGAGG
TACCTGGGCGGCTTCAAAGGCTTGCTTTTCAACGTGGAATTTGCAAAGTCTATGGTGAAGATGAGCAACATTGAGTTGAAGACCGGTACTGATGGTGAAATTCGCAAGATATGTTCTGCC
ATTAACTAG

Retrieve as FASTA