1. Browse the Database
  2. View Redoxidase
Entry information : GmPrx260 (Glyma15g13510.1)
Entry ID 9004
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-11-28 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-16 (Christophe Dunand)
Peroxidase information: GmPrx260 (Glyma15g13510.1)
Name (synonym) GmPrx260 (Glyma15g13510.1)
Class Class III peroxidase    [Orthogroup: Prx048]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx260
start..stop		 S start..stop
GmPrx69 687 0 1..350 1..348
PvPrx01 626 0 15..349 14..348
LaPrx03 577 0 1..348 6..354
LjPrx09 576 0 9..349 9..350
Gene structure Fichier Exons►


exon

Literature and cross-references GmPrx260 (Glyma15g13510.1)
DNA ref. Phytozome 12:   Gm15 (10122158..10124114)
Protein sequence: GmPrx260 (Glyma15g13510.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (326)
PWM (Da):   %s   37587.77 (35143.5) Transmb domain:   %s   i7-26o
PI (pH):   %s   5.6 (5.60) Peptide Signal:   %s   cut: 24 range:24-349
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKVTVVCCVLVVLVGALPFSSDAQLDPSFYRDTCPTVHSIVREVVRNVSKSDPRMLASLIRLHFHDCFVQGCDASILLNNTATIESEQQAFPNNNSIRGLDVVNQIKTAVENACPGVVSC
ADILALAAEISSVLAHGPDWKVPLGRRDSLTANRTLANQNLPAPFFNLTQLKDAFAVQGLNTTDLVALSGAHTIGKAQCRFFVDRLYNFSNTGNPDPTLNTTYLQTLSAICPNGGPGTNL
TNFDPTTPDTLDKNYYSNLQVHKGLLQSDQELFSTTGADTISIVNSFSSNQTLFFENFKASMIKMGNIGVLTGSQGEIRQQCNFVNGNSAGLATLATKESSEYGMVSSI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA ►
Send to BLAST
CDS►
Send to BLAST