Entry information : GmPrx262 (Glyma15g13540.1)
Entry ID 9005
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-11-28 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-16 (Christophe Dunand)
Peroxidase information: GmPrx262 (Glyma15g13540.1)
Name (synonym) GmPrx262 (Glyma15g13540.1)
Class Class III peroxidase    [Orthogroup: Prx044]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx262
start..stop
S start..stop
GmPrx24 629 0 1..322 1..322
GmPrx47 541 0 1..322 1..322
MtPrx26 518 0 1..322 1..325
GmPrx[P]261 515 0 1..322 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10138726..10138938 213 N° 2 10139898..10140089 192 N° 3 10140266..10140431 166 N° 4 10140935..10141330 396
N° 5 10141515..10141606 92  
join(10138726..10138938,10139898..10140089,10140266..10140431,10140935..10141330 ,10141515..10141606)


exon

Literature and cross-references GmPrx262 (Glyma15g13540.1)
DNA ref. Phytozome 12:   Gm15 (10138726..10141606)
Protein sequence: GmPrx262 (Glyma15g13540.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   353 (328)
PWM (Da):   %s   38129.95 (35515.6)  
PI (pH):   %s   4.26 (4.14) Peptide Signal:   %s   cut: 25 range:25-352
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNSLRLTICCVVAVLGALPHFSFAQLDPSFYDSTCSNVSSIVREVLSNVSQSDPRILASLIRLHFHDCFVQGCDASILLNDTDTIVSEQSAAPNNNSIRGLDVVNQIKTAVENACPGTVSCADILALAAQISSDLASGPVWEVPLGRRDSLTANQTLANQNLPAPTFTIDQLINSFGNQSLNITDLVALSGAHTIGRAQCRFFVDRLYNFSNTGNPDPTLNTTLLQSLQGICPNGGPGTNLTNLDLTTPDTFDSNYYSNLQLQNGLLQSDQELLSANNTDIVAIVNNFIMNQTLFFENFKASMRKMGNIGVLTGSQGEIRSQYAIEERTTELQRSQTLGLLTGFLSVDDWYA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTCCCTTCGTCTCACTATATGTTGTGTGGTGGCAGTGCTTGGAGCACTACCACACTTCTCATTTGCACAGCTAGATCCTTCATTTTACGATAGCACTTGTTCAAATGTAAGTTCA
ATTGTACGTGAGGTGCTCTCAAATGTTTCTCAATCTGATCCCCGCATACTTGCAAGTCTCATCAGGCTCCATTTTCACGACTGTTTTGTTCAG
GTAACTATAATTACTCTTCATATCATA
ACTCCATTCATAGTTTCTTGCTACTGCAGCTAACTCTTTTGCACGTCTTTTGTTTTTAAAGCAAATCCTTTCCTAGCTACTTCTATTACGTACCCCGAGCAAAACTCGTTTATCAAATCA
GTAATAATTTTTTCTTTTATATTAGATGGTTAAAATGCAAGAGTTCGTGAAAACATTTCTATAGAAATTTTAATGTTTTTAAATTAAGTGTTTTTTATTGAGAAGTAATTTAAATGAATG
TATTTCATTAATCTATTATATGAAATACATCAAATACATAAGAAAATATAGAAGAAGTGGTTGTATAATAGAAATAGAATAGGATAACAACCTACTATATAGTAACAACTATTTGAAATA
TAAATTAAAGATAAAATCAAATAGATAAAAATTATTTAAAATACAAATTGAAGATAATATCAACTAATAATTAAAACATAAATTCAAATTAAGAGATAACTATAATATATAGGTTTTAGC
TTTAAGTTTCAACTAAATAAGACTGTTGTATAGGATATATATATAGAGAGAGAGAGAGAACATGCATGTCTAAGTCGTTTCTATTTTTTTGCTTTTAAAATACTTATTTTAGAAATAATT
TTAAAAAATTAATAGATTTTCATAATTTCTGAGTAATGTTTAAGATCATGTTAGAAAATAATTTCATAAAAAAATGAGAACGGAATCAATCATGCATCTGGTCTCCATCTGAAATTTTTT
TCCGCTCAAAGTTATGAACTGGGGCCTCTGGCTCAACCACTCCTTATAATGTTATGTGTAAAGGAAAACGTGGTTGGAAATGTCAAGGTTTCCTTATCATATGGGCACTGATAAAAGTAC
GTTGAATAAAAGAGAGGAAAATAAAGTGTTGCTTTATTTTTTTTGTTGCTGAGAATTGAATTAATTATATATCCGCGGATATGATATGACAGGGGTGTGACGCATCAATTCTGTTGAACG
ACACGGATACGATCGTGAGCGAGCAAAGTGCAGCGCCAAACAACAACTCCATAAGAGGTTTGGATGTTGTGAACCAGATCAAAACAGCAGTGGAAAATGCTTGTCCCGGCACAGTTTCTT
GTGCTGATATTCTTGCTCTTGCAGCTCAAATATCTTCTGATCTG
GTATATATATGAAGAATTGGTTAAAACAAATCATCATCAAGAATATAACTAACTAAATTTCTTCGTGGAATTTTAA
TCTTAATATTGAAACCATAAGTTCGCAACAATTTTTGTTCACCTTTTGCATTCTATTTTGTCCAACTTATAGAGTTTTAGTACAACTATATATTTGGCAGGCTAGTGGTCCTGTTTGGGA
AGTTCCATTGGGAAGAAGGGATAGTTTGACAGCAAATCAAACCCTTGCTAATCAAAATCTTCCAGCTCCTACTTTTACCATTGATCAACTTATCAACTCATTTGGTAATCAAAGCCTCAA
CATTACTGATCTAGTTGCACTTTCAG
GTATGAATTTTTTTACATATAATAAATAAAAGGTTTTATAATGTGTGTTTACAAATATATATAGCAGGATTTTTTGGATTTTGTGTGAAATATT
TATTAATTTTATCAAATAATTAATATTTTTGAAAAATTTAATTAATTTTTTCAAGTGTTTTTTCAAATAAAATATTCAAATGAGACCTAAATCAGATATTTAAATCTAATTTCATTCGAA
CTAATAAGATAATATTAAATATACCTTGTTAAATGCATTAAATTATTTAAATAAGCAAACATTTAATGGCATGAGTTTTTTGTGTGTGTCCATATTGCTACTCTTATTTTATTATTTAAA
CTAATAGTTTAGATAAATTTTATGAAATTTGATTTAGGCAATGATGCTAGTTCTCTTTTGATATAAATACATTATTTATTTATAAAATTTTATTGTATATTTAGTATCACGTGTACAGAT
TAGAAAACCTTTTAATTGCATTAATTATTGAAAATGTTTCTTTTTTTAGGTGCTCATACAATTGGTAGAGCTCAATGTAGATTTTTTGTTGATCGATTATACAATTTCAGCAACACCGGC
AACCCAGATCCTACTCTAAACACAACTCTCTTGCAATCATTGCAAGGAATATGTCCTAATGGTGGACCTGGCACTAATCTCACTAATTTGGACTTAACCACTCCAGACACATTTGACTCC
AACTACTACTCCAATCTTCAACTTCAAAATGGCTTGCTTCAGAGTGATCAAGAGCTGCTTAGCGCAAATAATACGGATATCGTTGCCATTGTCAACAATTTCATTATGAACCAAACTCTT
TTCTTTGAAAACTTTAAGGCGTCAATGAGAAAAATGGGCAACATTGGAGTGCTAACGGGATCACAAGGAGAAATTCGATCACAAT
GTAATTCTGTGAATGGAAATTCTTCTGGACTCACT
ACTACTGCCACCAAAGAATCATCACAAGATAGCGTGGTTAGCTCAATGTAATAAATTGGCAAAGGTTGTGCTGAAAAATGCAGAGATTGAAGGTACTAGCTAATAAAAAGTTTTGTATTT
GCACATATATGGCATGTGCATGGAAACAGATGCGATTGAAGAGCGAACAACTGAGCTTCAGAGAAGTCAGACTTTGGGCTTGCTTACTGGCTTTCTTTCAGTGGATGATTGGTATGCTTG
A

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTCCCTTCGTCTCACTATATGTTGTGTGGTGGCAGTGCTTGGAGCACTACCACACTTCTCATTTGCACAGCTAGATCCTTCATTTTACGATAGCACTTGTTCAAATGTAAGTTCA
ATTGTACGTGAGGTGCTCTCAAATGTTTCTCAATCTGATCCCCGCATACTTGCAAGTCTCATCAGGCTCCATTTTCACGACTGTTTTGTTCAG
GGGTGTGACGCATCAATTCTGTTGAAC
GACACGGATACGATCGTGAGCGAGCAAAGTGCAGCGCCAAACAACAACTCCATAAGAGGTTTGGATGTTGTGAACCAGATCAAAACAGCAGTGGAAAATGCTTGTCCCGGCACAGTTTCT
TGTGCTGATATTCTTGCTCTTGCAGCTCAAATATCTTCTGATCTG
GCTAGTGGTCCTGTTTGGGAAGTTCCATTGGGAAGAAGGGATAGTTTGACAGCAAATCAAACCCTTGCTAATCAA
AATCTTCCAGCTCCTACTTTTACCATTGATCAACTTATCAACTCATTTGGTAATCAAAGCCTCAACATTACTGATCTAGTTGCACTTTCAG
GTGCTCATACAATTGGTAGAGCTCAATGT
AGATTTTTTGTTGATCGATTATACAATTTCAGCAACACCGGCAACCCAGATCCTACTCTAAACACAACTCTCTTGCAATCATTGCAAGGAATATGTCCTAATGGTGGACCTGGCACTAAT
CTCACTAATTTGGACTTAACCACTCCAGACACATTTGACTCCAACTACTACTCCAATCTTCAACTTCAAAATGGCTTGCTTCAGAGTGATCAAGAGCTGCTTAGCGCAAATAATACGGAT
ATCGTTGCCATTGTCAACAATTTCATTATGAACCAAACTCTTTTCTTTGAAAACTTTAAGGCGTCAATGAGAAAAATGGGCAACATTGGAGTGCTAACGGGATCACAAGGAGAAATTCGA
TCACAAT
ATGCGATTGAAGAGCGAACAACTGAGCTTCAGAGAAGTCAGACTTTGGGCTTGCTTACTGGCTTTCTTTCAGTGGATGATTGGTATGCTTGA

Retrieve as FASTA