1. Browse the Database
  2. View Redoxidase
Entry information : GmPrx270 (Glyma15g41280.1)
Entry ID 9007
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-10-12 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx270 (Glyma15g41280.1)
Name (synonym) GmPrx270 (Glyma15g41280.1)
Class Class III peroxidase    [Orthogroup: Prx022]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx270
start..stop		 S start..stop
GmPrx168 685 0 1..384 1..383
MtPrx82 579 0 5..384 7..389
PpePrx50 472 3.97e-168 61..380 8..343
VvPrx90 467 1.58e-165 13..384 13..375
Gene structure Fichier Exons►


exon

Literature and cross-references GmPrx270 (Glyma15g41280.1)
DNA ref. Phytozome 12:   Gm15 (48409243..48406385)
Protein sequence: GmPrx270 (Glyma15g41280.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   384 (338)
PWM (Da):   %s   42522.1 (35814.9)  
PI (pH):   %s   5.09 (7.62) Peptide Signal:   %s   cut: 25 range:25-362
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRSCINLWIVAALVIPVLLTLRSPRGETQTQTQTTSSFSDSSTFS
VKLANSFPFNQRIRDGSNLEYDFYMDTCPQAEGVVRSALTRIYFDHRDVAPALLRLFFHDCFIEGCDASLLLDENNGDRNLSVEKQAVPNQTLRGFDKIDLIKEEVEQACPGVVSCADILALAARDSIVLAGGPFYPVLTGRRDSHQSFFEEATDQIPRPDDNVTRTLNLFNLRGFNARETVSL
LGGHNIGKIGCDFIQQRLYNFQGTGQPDPSIPLDFLRQMRLNCPDSKNSSTSVDEFTISKMGMSYMQALSSSVSSGASFDTHYYQSLLRGRGLLFADQQLMAEEKTARLVSAYASDDGST
FRMDFARVMLKMSNLDVLTGLQGQVRVNCSLPVSS

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (5' end is missing, short PS at 3' end is missing). No EST.
DNA ►
Send to BLAST
CDS►
Send to BLAST